ELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6s7o:C | 78 | 78 | 1.0000 | 1.0000 | 1.0000 | 1.31e-51 | 6s7t:C |
2 | 6wkd:A | 280 | 23 | 0.1026 | 0.0286 | 0.3478 | 4.9 | 6wkf:A, 6wkh:A |
3 | 6fmr:A | 475 | 47 | 0.2436 | 0.0400 | 0.4043 | 5.3 | 4d2b:A, 4d2d:A, 5d58:A, 5d59:A, 6eia:A, 6fmy:A, 6ghj:A, 5oxl:A, 5oxm:A, 5oxn:A, 5oxo:A, 5oxq:A, 4xnj:A, 6yof:A, 6yog:A |
4 | 8i9z:CY | 382 | 28 | 0.1282 | 0.0262 | 0.3571 | 7.5 | |
5 | 8i9y:CY | 420 | 28 | 0.1282 | 0.0238 | 0.3571 | 8.6 | 8i9x:CY, 8ia0:CY |
6 | 4qsh:C | 1081 | 19 | 0.1410 | 0.0102 | 0.5789 | 9.5 | 4qsh:A, 4qsh:D, 4qsh:B, 4qsk:A, 4qsk:B |
7 | 6s32:D | 352 | 39 | 0.2051 | 0.0455 | 0.4103 | 9.9 | 6s32:A, 6s32:B, 6s32:C |