Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
EKTILNMARFIRSQALTILEKANELDADEIADIAESIHDHADEIYRSALARFG

The query sequence (length=53) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 1f4n:A 59 53 1.0000 0.8983 1.0000 1.41e-32 1f4m:A, 1f4m:C, 1f4m:E, 1f4n:B
2 1yo7:A 120 52 0.7925 0.3500 0.8077 4.92e-25 1yo7:B
3 1yo7:A 120 25 0.3962 0.1750 0.8400 7.10e-08 1yo7:B
4 8spc:A 370 48 0.3396 0.0486 0.3750 0.58 8spp:A
5 5x51:M 1386 51 0.3585 0.0137 0.3725 1.7 5x4z:A, 5x51:A, 8yfr:A
6 5xon:A 1427 37 0.2830 0.0105 0.4054 3.2 6a5l:A, 6a5o:A, 6a5p:A, 6a5r:A, 6a5t:A, 6a5u:A, 8h0v:A, 8h0w:A, 8he5:A, 6inq:A, 6ir9:A, 6j4w:A, 6j4x:A, 6j4y:A, 6j4z:A, 6j50:A, 6j51:A, 8jh2:A, 8jh3:A, 8jh4:A, 7wbv:A, 7wbw:A, 7wbx:A, 5x4z:M, 5x50:A, 7xn7:A, 5xog:A, 7xse:A, 7xsx:A, 7xsz:A, 7xt7:A, 7xtd:A, 7xti:A, 8yfq:A
7 8yon:C 605 38 0.2642 0.0231 0.3684 3.7 9imj:A, 8ylu:C, 8ylu:D, 8yo1:C, 8yo1:D, 8yo7:D, 8yo7:C, 8yod:C, 8yod:D, 8yon:D
8 4kp4:A 219 33 0.2453 0.0594 0.3939 5.5 1bxd:A
9 7w1y:2 706 40 0.2830 0.0212 0.3750 5.8 7pfo:2, 7plo:2, 8q6o:A, 8q6o:2, 8q6p:2, 7w1y:A, 6xtx:2, 6xty:2
10 8b9d:2 576 40 0.2830 0.0260 0.3750 6.3
11 6efn:A 383 34 0.2264 0.0313 0.3529 8.2

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218