BioLiP

>protein
EKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKNIYCLFRHPPGRVLP

The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2lhn:A	80	72	1.0000	0.9000	1.0000	6.48e-50	5l2l:A, 5l2l:B, 5l2l:F, 5l2l:E
2	4lj0:A	65	65	0.3056	0.3385	0.3385	0.001	4lj0:B
3	3zj2:A	71	28	0.1667	0.1690	0.4286	0.28
4	3zj2:A	71	17	0.1250	0.1268	0.5294	7.4
5	6bme:A	127	49	0.2083	0.1181	0.3061	2.8	6bme:B
6	3iar:A	360	28	0.1667	0.0333	0.4286	3.4	2bgn:E, 2bgn:F, 2bgn:G, 2bgn:H, 2e1w:A, 1krm:A, 1ndv:A, 1ndw:A, 1ndy:A, 1ndz:A, 1o5r:A, 1qxl:A, 7rtg:A, 7rtg:B, 1uml:A, 1v79:A, 1v7a:A, 1vfl:A, 1w1i:E, 1w1i:F, 1w1i:G, 1w1i:H, 1wxy:A, 1wxz:A, 2z7g:A
7	5xrs:G	321	19	0.1389	0.0312	0.5263	4.9	5xrs:A, 5xrs:C
8	4uny:C	330	22	0.1250	0.0273	0.4091	6.7	4unx:A, 4unx:C, 4unx:E, 4uny:A, 4uny:E, 4unz:A, 4unz:C, 4unz:E, 4uo1:A, 4uo1:C, 4uo1:E, 4uo2:A, 4uo2:C, 4uo2:E, 4uo5:A, 4uo5:C, 4uo5:E, 4uo6:A, 4uo7:A, 4uo7:C, 4uo7:E, 4uo8:A
9	6wzt:A	494	15	0.1250	0.0182	0.6000	7.9	6aos:A, 6aot:A, 6aou:A, 6aov:A, 6bkr:A, 6bks:A, 6bkt:A, 6cex:D, 6cex:B, 3eym:B, 3eym:D, 3eym:F, 8faw:A, 1hgg:B, 1hgg:D, 1hgg:F, 1hgh:B, 1hgh:D, 1hgh:F, 1htm:B, 1htm:D, 1htm:F, 6nsa:A, 6nsb:A, 6nsf:A, 6nsg:A, 5t6n:B, 5t6n:D, 5t6n:F, 8tj6:B, 8tj9:A, 8tja:A, 8tjb:A, 4uny:D, 4uo0:D, 8uwa:B, 4wea:A, 2yp3:A, 2yp4:A, 2yp5:A, 2yp8:A, 2yp9:A
10	7n8n:B	202	37	0.1389	0.0495	0.2703	8.7	7lv8:D, 7lv8:C, 7lv8:H, 7lv8:G, 7lv9:C, 7lv9:D, 7n8n:D
11	8tj4:A	317	15	0.1250	0.0284	0.6000	8.8	8tj4:C, 8tj4:E, 8tj4:G, 8tj6:A, 8tj6:C, 8tj6:E, 8tj6:G, 8tj7:A
12	8tj8:A	317	15	0.1250	0.0284	0.6000	9.7

[Back]