EKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMDTLHQAGYLKIGLVGE
The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8vgc:A | 75 | 75 | 1.0000 | 1.0000 | 1.0000 | 5.55e-51 | 8p9r:A, 8p9r:B, 8vgc:B, 8vgd:A, 8vgd:B |
2 | 6pe2:A | 456 | 75 | 0.2667 | 0.0439 | 0.2667 | 0.19 | 6p5a:A, 6p5a:G, 6pe2:G |
3 | 4cmy:B | 164 | 43 | 0.1867 | 0.0854 | 0.3256 | 0.48 | 4cmy:A, 4cmy:C, 4cmy:D, 4cmy:E, 4cmy:F, 4cmy:G, 4cmy:H, 4cmy:I, 4cmy:J, 4cmy:K, 4cmy:L, 4cmy:M, 4cmy:N, 4cmy:O, 4cmy:P, 4cmy:Q, 4cmy:R, 4cmy:S, 4cmy:T, 4cmy:U, 4cmy:V, 4cmy:W, 4cmy:X |
4 | 7xsh:A | 548 | 41 | 0.2400 | 0.0328 | 0.4390 | 3.6 | 7xsh:B |
5 | 6nzj:A | 273 | 52 | 0.1867 | 0.0513 | 0.2692 | 4.7 | 6nzj:B |
6 | 6qfb:C | 1011 | 29 | 0.1467 | 0.0109 | 0.3793 | 6.5 | |
7 | 6dig:A | 182 | 56 | 0.1733 | 0.0714 | 0.2321 | 7.1 | 7kei:A, 1uvq:A |
8 | 5e6u:A | 583 | 22 | 0.1467 | 0.0189 | 0.5000 | 7.1 | 5e6r:A, 5e6s:A, 5e6s:C, 5e6s:E |