EKDDEEADAIYAALDKRMDERRKERREQREKEEKIQQQFSDLKRKLAEVTEEEWLSIPEV
The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8qpk:N | 133 | 68 | 0.9833 | 0.4436 | 0.8676 | 3.60e-32 | |
2 | 6qw6:5J | 803 | 69 | 1.0000 | 0.0747 | 0.8696 | 1.32e-29 | 8h6e:4G, 8h6j:4G, 8h6k:4G, 8h6l:4G, 8qp8:N, 6qx9:5J, 8y6o:G |
3 | 8qoz:N | 457 | 68 | 0.9833 | 0.1291 | 0.8676 | 1.98e-29 | 8qpa:N, 8qpb:N |
4 | 8r09:N | 834 | 68 | 0.9833 | 0.0707 | 0.8676 | 4.12e-29 | 6ahd:N, 5o9z:G, 8q7n:N, 8qo9:N, 8qpe:N, 8qzs:N, 8r0b:N, 8rc0:E, 8rm5:N |
5 | 3jcm:G | 734 | 49 | 0.2833 | 0.0232 | 0.3469 | 5.34e-05 | 5zwm:N, 5zwo:N |
6 | 5nrl:J | 800 | 33 | 0.2500 | 0.0187 | 0.4545 | 2.46e-04 | 5gan:J, 5gap:J |
7 | 7d4i:RP | 2084 | 25 | 0.2000 | 0.0058 | 0.4800 | 4.7 | 7d5t:RP |
8 | 6lqs:RP | 2180 | 25 | 0.2000 | 0.0055 | 0.4800 | 4.7 | 7d63:RP, 6lqp:RP, 6lqq:RP, 6lqr:RP, 6lqt:RP, 6lqu:RP, 6lqv:RP |
9 | 7uhy:D | 288 | 35 | 0.1833 | 0.0382 | 0.3143 | 5.9 | |
10 | 3pfo:A | 426 | 50 | 0.2500 | 0.0352 | 0.3000 | 8.0 | 3pfo:B |
11 | 7oya:O1 | 204 | 38 | 0.1667 | 0.0490 | 0.2632 | 9.8 | 7oyb:O1 |