EKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDRGNLLQCICTGNG
RGEWKCER
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2rky:C | 92 | 89 | 1.0000 | 0.9565 | 0.9888 | 3.03e-60 | 2rky:A, 2rl0:A, 2rl0:B, 2rl0:D, 2rl0:F, 2rl0:K |
2 | 2rl0:I | 79 | 87 | 0.8977 | 1.0000 | 0.9080 | 5.19e-52 | |
3 | 2rkz:C | 90 | 89 | 0.5000 | 0.4889 | 0.4944 | 1.26e-23 | 3cal:A, 3cal:C, 4pz5:A, 2rkz:A, 2rkz:B, 2rkz:D, 2rkz:E, 2rkz:F, 3zrz:A, 3zrz:B |
4 | 3ejh:A | 91 | 78 | 0.3750 | 0.3626 | 0.4231 | 1.01e-17 | 3ejh:B, 3gxe:B, 3gxe:A |
5 | 3ejh:A | 91 | 44 | 0.1818 | 0.1758 | 0.3636 | 0.029 | 3ejh:B, 3gxe:B, 3gxe:A |
6 | 3m7p:A | 301 | 77 | 0.3295 | 0.0963 | 0.3766 | 2.33e-10 | |
7 | 3m7p:A | 301 | 42 | 0.1818 | 0.0532 | 0.3810 | 0.077 | |
8 | 1o9a:A | 93 | 47 | 0.2841 | 0.2688 | 0.5319 | 2.97e-10 | |
9 | 1o9a:A | 93 | 88 | 0.3636 | 0.3441 | 0.3636 | 1.61e-09 | |
10 | 7eoz:A | 482 | 33 | 0.1364 | 0.0249 | 0.3636 | 0.49 | 7eoz:B |
11 | 6nf4:A | 421 | 29 | 0.1250 | 0.0261 | 0.3793 | 2.0 | 6nf4:B |
12 | 8fgw:A | 1081 | 72 | 0.2045 | 0.0167 | 0.2500 | 4.0 | |
13 | 2xzl:A | 756 | 30 | 0.1250 | 0.0146 | 0.3667 | 8.1 |