EKARWYAVQVASGCEKRVKATLEQRVQTLDAANRILQVEIPETPIVKLKKDGSRQSAEEKVFPGYVLVRMILDDDAWQIV
RNTPHVINFVGAEQKRPYGRGRGHVKPMPLSPGEVGRIFK
The query sequence (length=120) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8syi:G | 120 | 120 | 1.0000 | 1.0000 | 1.0000 | 1.26e-86 | 8urw:G |
2 | 8e74:Z | 122 | 91 | 0.3833 | 0.3770 | 0.5055 | 5.44e-27 | 8e82:Z |
3 | 8ehq:G | 110 | 117 | 0.4250 | 0.4636 | 0.4359 | 1.32e-25 | 8ej3:G, 8eoe:G, 8eof:G, 8exy:G |
4 | 5ms0:F | 181 | 96 | 0.3083 | 0.2044 | 0.3854 | 1.78e-21 | 6c6u:N, 8e3f:F, 8e5k:F, 8e5o:F, 8e6x:F, 8e6z:F, 8g31:u, 8g34:u, 6gov:G, 7py0:G, 7py1:G, 7py5:G, 7py8:G, 6tqn:G, 6tqo:G, 6vu3:AB, 6vyq:AB, 6vyr:AB, 6vys:AB, 6vyt:AB, 6vyu:AB, 6vyw:AB, 6vyx:AB, 6vyy:AB, 6vyz:AB, 6vz2:AB, 6vz3:AB, 6vz5:AB, 6vz7:AB, 6x6t:AB, 6x7f:AB, 6x7k:AB, 6x9q:AB, 6xdq:AB, 6xdr:AB, 6xgf:AB, 6xii:AB, 6xij:AB, 6z9p:G, 6z9q:G, 6z9r:G, 6ztj:CF, 6ztl:CF, 6ztn:CF |
5 | 6xav:L | 95 | 96 | 0.3000 | 0.3789 | 0.3750 | 2.31e-17 | |
6 | 8f5g:C | 175 | 78 | 0.1750 | 0.1200 | 0.2692 | 0.079 | 8f5g:A |
7 | 8f5g:B | 144 | 76 | 0.1750 | 0.1458 | 0.2763 | 0.15 | |
8 | 6fm7:A | 356 | 56 | 0.1333 | 0.0449 | 0.2857 | 1.3 | |
9 | 8xvg:L | 3485 | 66 | 0.1583 | 0.0055 | 0.2879 | 1.3 | 8xvv:L |
10 | 7ktr:A | 3042 | 66 | 0.1583 | 0.0062 | 0.2879 | 1.5 | |
11 | 8phk:P | 162 | 90 | 0.1750 | 0.1296 | 0.2333 | 1.5 | 6c6s:D, 6c6t:D, 8pen:P, 8pfj:P, 8pid:P, 8pil:P, 8pim:P, 8upo:AB, 8upr:AB, 8uql:AB, 8uqm:AB, 8uqp:AB, 8ur0:AB, 8urh:AB, 8uri:AB, 8urx:AB, 8ury:AB |
12 | 6gw3:A | 383 | 38 | 0.1250 | 0.0392 | 0.3947 | 4.4 | 6gw3:B, 6gw3:C, 6gw3:D, 7w6g:C, 7w6g:D |
13 | 6zhh:A | 883 | 44 | 0.1167 | 0.0159 | 0.3182 | 6.9 | 6zhf:A, 6zhg:A, 6zhh:B, 6zhh:C, 6zhh:D, 6zhh:E, 6zhh:F, 6zhh:G, 6zhh:H |
14 | 6ap1:B | 322 | 110 | 0.2000 | 0.0745 | 0.2182 | 9.2 | 6ap1:A, 6ap1:C, 6ap1:D, 6ap1:E, 6bmf:A, 6bmf:B, 6bmf:C, 6bmf:D, 6bmf:E, 3eih:A, 3eih:B, 3eih:C, 6ndy:A, 6ndy:B, 6ndy:C, 6ndy:D, 6ndy:E, 6oo2:A, 6oo2:B, 6oo2:C, 6oo2:D, 6oo2:E, 2qpa:A, 5uie:A, 5uie:B, 5uie:C, 5uie:D, 5uie:E, 5xmi:B, 5xmi:C, 5xmi:D, 5xmi:E, 5xmi:F, 5xmk:B, 5xmk:C, 5xmk:D, 5xmk:E, 5xmk:F |
15 | 3cdz:A | 630 | 32 | 0.1000 | 0.0190 | 0.3750 | 9.7 | 3j2q:A |
16 | 6mf2:A | 1222 | 32 | 0.1000 | 0.0098 | 0.3750 | 9.9 | 4bdv:A, 4bdv:B, 3cdz:B, 3j2q:B, 5k8d:A, 5k8d:B, 2r7e:B |