EKACRHCHYITSEDRCPVCGSRDLSEEWFDLVIIVDVENSEIAKKIGAKVPGKYAIRV
The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1ryq:A | 64 | 58 | 1.0000 | 0.9062 | 1.0000 | 3.40e-38 | 8oki:I, 8p2i:I, 3p8b:A, 3p8b:C, 3qqc:E |
2 | 9bct:I | 65 | 64 | 0.8276 | 0.7385 | 0.7500 | 9.02e-29 | |
3 | 4zn3:B | 67 | 57 | 0.4655 | 0.4030 | 0.4737 | 2.48e-13 | 3lpe:B, 3lpe:D, 3lpe:F, 3lpe:H, 4zn1:B |
4 | 7fse:A | 1040 | 28 | 0.2241 | 0.0125 | 0.4643 | 0.005 | 8ofb:A, 3oiy:A, 3p4x:A |
5 | 4ddt:A | 1102 | 28 | 0.2241 | 0.0118 | 0.4643 | 0.005 | 4ddu:A, 4ddv:A, 4ddv:B, 4ddw:A, 4ddx:A, 4ddx:B, 7fsf:A |
6 | 3fzy:A | 216 | 50 | 0.2931 | 0.0787 | 0.3400 | 0.15 | 3eeb:A, 3eeb:B, 3fzy:B, 3gcd:A, 3gcd:B, 3gcd:C, 3gcd:D, 8yja:A, 8yja:B, 8yjc:A |
7 | 5zvq:A | 194 | 22 | 0.1379 | 0.0412 | 0.3636 | 0.62 | 8ab0:F, 8ab0:E, 8bpr:E, 8bpr:F |
8 | 6knb:B | 1120 | 19 | 0.1552 | 0.0080 | 0.4737 | 0.92 | 6knc:B |
9 | 2aou:B | 289 | 33 | 0.1897 | 0.0381 | 0.3333 | 1.2 | 2aot:A, 2aot:B, 2aou:A, 2aov:A, 2aov:B, 2aow:A, 2aow:B, 2aox:A, 2aox:B, 1jqd:A, 1jqd:B, 1jqe:A, 1jqe:B |
10 | 5z2v:B | 197 | 17 | 0.1207 | 0.0355 | 0.4118 | 1.3 | 5z2v:A |
11 | 1gwe:A | 498 | 24 | 0.1552 | 0.0181 | 0.3750 | 1.5 | 1gwf:A, 1gwh:A, 1hbz:A |
12 | 8ab0:D | 157 | 22 | 0.1552 | 0.0573 | 0.4091 | 2.3 | 8bpr:D |
13 | 7dvq:6 | 105 | 28 | 0.1379 | 0.0762 | 0.2857 | 2.7 | 7abg:y, 7abh:y, 7abi:y, 7b0i:D, 7b91:D, 7b92:D, 7b9c:D, 8ch6:D, 6en4:D, 7evn:D, 7evo:6, 6ff4:y, 8hk1:6, 8i0p:7, 8i0r:7, 8i0s:7, 8i0t:7, 8i0u:7, 8i0v:7, 5ife:D, 7omf:D, 7onb:D, 7opi:D, 7q3l:G, 7q4o:G, 7q4p:G, 7qtt:D, 6qx9:BP, 8r08:BP, 5syb:A, 5syb:B, 7vpx:6, 6y50:y, 8y7e:6, 5z56:6, 5z57:6, 5z58:6, 5zya:D |
14 | 2qlt:A | 251 | 17 | 0.1207 | 0.0279 | 0.4118 | 3.7 | |
15 | 8rxh:SA | 244 | 27 | 0.1724 | 0.0410 | 0.3704 | 4.8 | 8a3w:SA, 8a98:SA, 6az1:A, 8ovj:SA, 8rxx:SA, 5t2a:0 |
16 | 3o6x:A | 638 | 49 | 0.2241 | 0.0204 | 0.2653 | 5.0 | 3o6x:B, 3o6x:C, 3o6x:D, 3o6x:E, 3o6x:F |
17 | 5ijl:A | 943 | 19 | 0.1379 | 0.0085 | 0.4211 | 5.4 | |
18 | 6btm:B | 948 | 18 | 0.1207 | 0.0074 | 0.3889 | 5.5 | |
19 | 8ppt:B | 1191 | 19 | 0.1379 | 0.0067 | 0.4211 | 6.1 | 8ppu:B, 8ppv:B, 6t8h:B |
20 | 7mqa:LO | 819 | 28 | 0.1897 | 0.0134 | 0.3929 | 7.1 | |
21 | 7mq8:LO | 848 | 28 | 0.1897 | 0.0130 | 0.3929 | 7.1 | 7mq9:LO |
22 | 2x41:A | 715 | 33 | 0.2414 | 0.0196 | 0.4242 | 8.3 | 2x42:A |
23 | 7zgm:A | 702 | 42 | 0.2241 | 0.0185 | 0.3095 | 9.1 | |
24 | 4x2z:A | 301 | 25 | 0.1379 | 0.0266 | 0.3200 | 9.1 | 5bz0:A |