EIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLA
The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8ttl:A | 90 | 36 | 1.0000 | 0.4000 | 1.0000 | 4.01e-20 | 7sp1:B, 7sp1:C, 7sp1:F, 7sp1:G, 7sp1:J, 7sp1:L, 7sp1:N, 7sp1:A, 7sp1:D, 7sp1:E, 7sp1:H, 7sp1:I, 7sp1:K, 7sp1:M, 7sp1:O, 8ttl:B, 8ttl:C |
| 2 | 1z45:A | 674 | 22 | 0.2778 | 0.0148 | 0.4545 | 1.5 | |
| 3 | 5xun:B | 171 | 26 | 0.3056 | 0.0643 | 0.4231 | 5.7 | 5xun:A |
umich.edu