EIVEPEFPHNAIEPCVICQTRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6sqr:A | 69 | 68 | 1.0000 | 0.9855 | 1.0000 | 1.07e-45 | 7ai0:AAA, 7ai0:DDD, 7ai1:AAA, 7ai1:DDD, 2hdp:A, 2hdp:B, 5mnj:C, 5mnj:G, 6sqo:A, 6sqo:D, 6sqp:A, 6sqp:B, 6sqp:C, 6sqp:D, 6sqr:D, 6sqr:G, 6sqr:J, 6sqs:A, 6sqs:D, 2vje:A, 2vje:C, 2vjf:A, 2vjf:C |
2 | 7ahz:GGG | 60 | 58 | 0.7647 | 0.8667 | 0.8966 | 1.56e-35 | 7ahy:AAA, 7ahy:BBB, 7ahz:AAA, 7ahz:DDD, 7ahz:JJJ |
3 | 7ah2:AAA | 58 | 56 | 0.6765 | 0.7931 | 0.8214 | 7.41e-31 | 7ah2:BBB |
4 | 7mla:A | 67 | 67 | 0.3971 | 0.4030 | 0.4030 | 1.34e-18 | 5mnj:D, 5mnj:H, 2vje:B, 2vje:D, 2vjf:B, 2vjf:D |
5 | 3t6p:A | 330 | 52 | 0.2794 | 0.0576 | 0.3654 | 0.006 | 3d9t:A, 3d9t:B, 3d9u:A, 8dsf:A, 8dsf:B, 8dsf:C, 8dsf:D, 8dso:D, 4eb9:A, 4eb9:B, 4eb9:C, 4eb9:D, 6exw:A, 6exw:C, 6hpr:A, 4hy4:A, 4hy4:B, 4hy5:A, 4hy5:B, 4lge:A, 4lge:B, 4lgu:A, 4lgu:B, 5m6n:A, 5m6n:B, 4mti:A, 4mti:B, 3mup:A, 3mup:B, 3mup:C, 3mup:D, 4mu7:A, 4mu7:B, 3oz1:A, 3oz1:B, 3oz1:C, 3oz1:D, 1qbh:A, 7trm:A, 3uw4:A, 6w74:A, 6w7o:C, 6w7o:D, 6w8i:F, 6w8i:D, 6w8i:E |
6 | 3eb5:A | 65 | 45 | 0.2647 | 0.2769 | 0.4000 | 0.016 | 3eb6:A |
7 | 6k2k:A | 57 | 54 | 0.2647 | 0.3158 | 0.3333 | 0.037 | 6m2c:E, 6m2c:F, 6m2c:G, 6m2c:H, 6m2d:A, 6m2d:B, 6m2d:C, 6m2d:D, 6m2d:E, 6m2d:F |
8 | 2yho:E | 70 | 36 | 0.1912 | 0.1857 | 0.3611 | 0.093 | 2yhn:A, 2yhn:B, 2yho:A, 2yho:C, 2yho:G |
9 | 1chc:A | 68 | 28 | 0.1324 | 0.1324 | 0.3214 | 0.23 | |
10 | 2jrp:A | 81 | 43 | 0.2500 | 0.2099 | 0.3953 | 0.27 | |
11 | 6f98:A | 78 | 27 | 0.1471 | 0.1282 | 0.3704 | 0.58 | |
12 | 5zi6:A | 55 | 32 | 0.1765 | 0.2182 | 0.3750 | 0.63 | 5zi6:B, 5zi6:C, 5zi6:D, 5zi6:E, 5zi6:F, 5zi6:G, 5zi6:H |
13 | 4iqy:A | 221 | 40 | 0.2206 | 0.0679 | 0.3750 | 1.5 | 4iqy:B |
14 | 4auq:B | 57 | 53 | 0.2794 | 0.3333 | 0.3585 | 2.1 | 4auq:E |
15 | 6skz:A | 2638 | 27 | 0.1765 | 0.0045 | 0.4444 | 2.2 | 6sl0:A, 6sl0:B |
16 | 3lrq:D | 84 | 27 | 0.1471 | 0.1190 | 0.3704 | 2.9 | 3lrq:A, 3lrq:B, 3lrq:C |
17 | 4df9:C | 405 | 28 | 0.1471 | 0.0247 | 0.3571 | 3.0 | 4df9:A, 4df9:B, 4df9:D, 4df9:E, 4df9:F |
18 | 6akd:A | 488 | 22 | 0.1471 | 0.0205 | 0.4545 | 3.1 | |
19 | 3p1v:A | 406 | 30 | 0.1324 | 0.0222 | 0.3000 | 3.7 | 3p1v:B |
20 | 4axd:A | 433 | 9 | 0.0882 | 0.0139 | 0.6667 | 4.1 | 4aqk:A, 4axe:A, 6fjk:A, 6fl3:A, 6fl8:A, 2xal:A, 2xal:B, 2xam:A, 2xam:B, 2xan:B, 2xao:B, 2xar:A, 2xar:B |
21 | 8dqv:B | 322 | 24 | 0.1471 | 0.0311 | 0.4167 | 4.4 | 8dqv:D, 7utd:B, 7utd:D, 7utd:F, 7utd:H, 7utd:J, 7utd:L, 7utd:N, 7utd:P, 7uur:D, 7uur:G, 7uus:B, 7uus:D, 7uus:F, 7uus:H, 7uus:J, 7uus:L, 7uus:N, 7uus:P |
22 | 2ecg:A | 75 | 45 | 0.2647 | 0.2400 | 0.4000 | 5.0 | 4ic2:A, 4ic2:B, 4ic3:A, 4ic3:B, 5o6t:A, 5o6t:B, 8w59:A, 8w59:B, 8w5a:A, 8w5a:B |
23 | 6o7i:A | 741 | 47 | 0.1765 | 0.0162 | 0.2553 | 5.8 | |
24 | 6muu:A | 780 | 47 | 0.1765 | 0.0154 | 0.2553 | 5.9 | 6iqw:A, 6mur:A, 6mus:A, 6mut:A, 6o7e:A, 6o7h:A |
25 | 5g1n:E | 307 | 34 | 0.1618 | 0.0358 | 0.3235 | 5.9 | 5g1n:A, 5g1n:B, 5g1n:C, 5g1n:D, 5g1n:F, 5g1p:A, 5g1p:B, 5g1p:C, 5g1p:D, 5g1p:E, 5g1p:F |
26 | 5d0m:C | 60 | 54 | 0.2353 | 0.2667 | 0.2963 | 5.9 | 5ulh:C, 5ulk:C |
27 | 1jhd:A | 396 | 25 | 0.1618 | 0.0278 | 0.4400 | 6.2 | |
28 | 7t92:C | 317 | 43 | 0.1618 | 0.0347 | 0.2558 | 6.6 | |
29 | 4r7e:A | 69 | 59 | 0.2206 | 0.2174 | 0.2542 | 7.8 | 8ieg:A, 8ieg:B, 8t3t:K, 8t3t:L, 8t3w:K, 8t3w:L, 8t3y:K, 8t3y:L |
30 | 2ea5:A | 68 | 58 | 0.2647 | 0.2647 | 0.3103 | 9.0 |