Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP Library
>protein
EIVEPEFPHNAIEPCVICQTRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP

The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6sqr:A 69 68 1.0000 0.9855 1.0000 1.07e-45 7ai0:AAA, 7ai0:DDD, 7ai1:AAA, 7ai1:DDD, 2hdp:A, 2hdp:B, 5mnj:C, 5mnj:G, 6sqo:A, 6sqo:D, 6sqp:A, 6sqp:B, 6sqp:C, 6sqp:D, 6sqr:D, 6sqr:G, 6sqr:J, 6sqs:A, 6sqs:D, 2vje:A, 2vje:C, 2vjf:A, 2vjf:C
2 7ahz:GGG 60 58 0.7647 0.8667 0.8966 1.56e-35 7ahy:AAA, 7ahy:BBB, 7ahz:AAA, 7ahz:DDD, 7ahz:JJJ
3 7ah2:AAA 58 56 0.6765 0.7931 0.8214 7.41e-31 7ah2:BBB
4 7mla:A 67 67 0.3971 0.4030 0.4030 1.34e-18 5mnj:D, 5mnj:H, 2vje:B, 2vje:D, 2vjf:B, 2vjf:D
5 3t6p:A 330 52 0.2794 0.0576 0.3654 0.006 3d9t:A, 3d9t:B, 3d9u:A, 8dsf:A, 8dsf:B, 8dsf:C, 8dsf:D, 8dso:D, 4eb9:A, 4eb9:B, 4eb9:C, 4eb9:D, 6exw:A, 6exw:C, 6hpr:A, 4hy4:A, 4hy4:B, 4hy5:A, 4hy5:B, 4lge:A, 4lge:B, 4lgu:A, 4lgu:B, 5m6n:A, 5m6n:B, 4mti:A, 4mti:B, 3mup:A, 3mup:B, 3mup:C, 3mup:D, 4mu7:A, 4mu7:B, 3oz1:A, 3oz1:B, 3oz1:C, 3oz1:D, 1qbh:A, 7trm:A, 3uw4:A, 6w74:A, 6w7o:C, 6w7o:D, 6w8i:F, 6w8i:D, 6w8i:E
6 3eb5:A 65 45 0.2647 0.2769 0.4000 0.016 3eb6:A
7 6k2k:A 57 54 0.2647 0.3158 0.3333 0.037 6m2c:E, 6m2c:F, 6m2c:G, 6m2c:H, 6m2d:A, 6m2d:B, 6m2d:C, 6m2d:D, 6m2d:E, 6m2d:F
8 2yho:E 70 36 0.1912 0.1857 0.3611 0.093 2yhn:A, 2yhn:B, 2yho:A, 2yho:C, 2yho:G
9 1chc:A 68 28 0.1324 0.1324 0.3214 0.23
10 2jrp:A 81 43 0.2500 0.2099 0.3953 0.27
11 6f98:A 78 27 0.1471 0.1282 0.3704 0.58
12 5zi6:A 55 32 0.1765 0.2182 0.3750 0.63 5zi6:B, 5zi6:C, 5zi6:D, 5zi6:E, 5zi6:F, 5zi6:G, 5zi6:H
13 4iqy:A 221 40 0.2206 0.0679 0.3750 1.5 4iqy:B
14 4auq:B 57 53 0.2794 0.3333 0.3585 2.1 4auq:E
15 6skz:A 2638 27 0.1765 0.0045 0.4444 2.2 6sl0:A, 6sl0:B
16 3lrq:D 84 27 0.1471 0.1190 0.3704 2.9 3lrq:A, 3lrq:B, 3lrq:C
17 4df9:C 405 28 0.1471 0.0247 0.3571 3.0 4df9:A, 4df9:B, 4df9:D, 4df9:E, 4df9:F
18 6akd:A 488 22 0.1471 0.0205 0.4545 3.1
19 3p1v:A 406 30 0.1324 0.0222 0.3000 3.7 3p1v:B
20 4axd:A 433 9 0.0882 0.0139 0.6667 4.1 4aqk:A, 4axe:A, 6fjk:A, 6fl3:A, 6fl8:A, 2xal:A, 2xal:B, 2xam:A, 2xam:B, 2xan:B, 2xao:B, 2xar:A, 2xar:B
21 8dqv:B 322 24 0.1471 0.0311 0.4167 4.4 8dqv:D, 7utd:B, 7utd:D, 7utd:F, 7utd:H, 7utd:J, 7utd:L, 7utd:N, 7utd:P, 7uur:D, 7uur:G, 7uus:B, 7uus:D, 7uus:F, 7uus:H, 7uus:J, 7uus:L, 7uus:N, 7uus:P
22 2ecg:A 75 45 0.2647 0.2400 0.4000 5.0 4ic2:A, 4ic2:B, 4ic3:A, 4ic3:B, 5o6t:A, 5o6t:B, 8w59:A, 8w59:B, 8w5a:A, 8w5a:B
23 6o7i:A 741 47 0.1765 0.0162 0.2553 5.8
24 6muu:A 780 47 0.1765 0.0154 0.2553 5.9 6iqw:A, 6mur:A, 6mus:A, 6mut:A, 6o7e:A, 6o7h:A
25 5g1n:E 307 34 0.1618 0.0358 0.3235 5.9 5g1n:A, 5g1n:B, 5g1n:C, 5g1n:D, 5g1n:F, 5g1p:A, 5g1p:B, 5g1p:C, 5g1p:D, 5g1p:E, 5g1p:F
26 5d0m:C 60 54 0.2353 0.2667 0.2963 5.9 5ulh:C, 5ulk:C
27 1jhd:A 396 25 0.1618 0.0278 0.4400 6.2
28 7t92:C 317 43 0.1618 0.0347 0.2558 6.6
29 4r7e:A 69 59 0.2206 0.2174 0.2542 7.8 8ieg:A, 8ieg:B, 8t3t:K, 8t3t:L, 8t3w:K, 8t3w:L, 8t3y:K, 8t3y:L
30 2ea5:A 68 58 0.2647 0.2647 0.3103 9.0

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417