BioLiP

>protein
EINEPPPNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLICVRCATQRNICQCCMLDSRWHIP
IQLRDHLISLVNEENVMTEEAKNDMMKRFLSLKNVKLGGAQITSDPSEADNIVDKLKNILLKNPSTKSFFLYNIDASIPE
WKITDTVSQLLLSLIVNHKAKCGGLRFQSSELGERFVSKIIFIIPWSSTAENIKLSLSLNKLIQLEL

The query sequence (length=227) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5mps:N	227	227	1.0000	1.0000	1.0000	1.55e-168	5lj3:N, 5lj5:N, 5mq0:N
2	7b9v:N	264	264	0.9868	0.8485	0.8485	2.09e-153
3	6exn:N	242	246	0.9648	0.9050	0.8902	2.57e-152	6bk8:F
4	7dco:Q	292	290	1.0000	0.7774	0.7828	5.56e-152	6j6g:Q, 6j6h:Q, 6j6n:Q, 6j6q:Q
5	5gm6:Q	185	208	0.8062	0.9892	0.8798	1.44e-128	5gmk:Q, 5wsg:Q, 5ylz:M
6	5y88:M	182	191	0.6520	0.8132	0.7749	1.17e-100
7	3jb9:a	255	193	0.2775	0.2471	0.3264	6.13e-26
8	8ro0:O	342	156	0.2203	0.1462	0.3205	2.69e-18	8ro1:O
9	8ch6:U	295	126	0.2026	0.1559	0.3651	3.46e-17	7a5p:P, 8c6j:M, 6ff4:P, 6ff7:P, 9fmd:O, 8i0p:O, 8i0r:O, 8i0s:O, 8i0t:O, 8i0u:O, 8i0v:O, 8i0w:O, 6icz:O, 6id0:O, 6id1:O, 5mqf:P, 6qdv:M, 7qtt:U, 8ro2:O, 7w59:O, 7w5a:O, 7w5b:O, 5xjc:O, 5yzg:O, 5z56:O, 5z57:O, 6zym:P
10	7abi:P	237	206	0.2555	0.2447	0.2816	1.03e-16	7aav:P, 7abg:P
11	5xkd:A	445	32	0.0529	0.0270	0.3750	0.65	5xkd:B, 5xkd:C, 5xkd:D
12	3ngl:A	275	41	0.0617	0.0509	0.3415	2.6	3ngl:C
13	5nz8:A	884	56	0.0749	0.0192	0.3036	3.7
14	2qtt:A	248	48	0.0617	0.0565	0.2917	4.0	2h8g:A, 2h8g:B, 3lgs:A, 3lgs:B, 3lgs:C, 3lgs:D, 2qtg:A, 2qtg:B, 2qtt:B
15	5a0u:H	795	45	0.0749	0.0214	0.3778	4.3	5a0u:A, 5a0u:B, 5a0u:C, 5a0u:D, 5a0u:E, 5a0u:F, 5a0u:G, 9f3w:A, 9f3w:B, 9f3w:C, 9f3w:D, 9f3w:E, 9f3w:F, 9f3w:G, 9f3w:H, 9f3x:A, 9f3x:B, 9f3x:C, 9f3x:D, 9f3x:E, 9f3x:F, 9f3x:G, 9f3x:H, 9f3y:A, 9f3y:B, 9f3y:C, 9f3y:D, 9f3y:E, 9f3y:F, 9f3y:G, 9f3y:H
16	8h8j:C	283	28	0.0485	0.0389	0.3929	5.4
17	8p5d:SE0	260	126	0.1189	0.1038	0.2143	5.7	8p60:SE0, 8p60:RE0, 7qca:SE0
18	5dgk:A	519	46	0.0661	0.0289	0.3261	7.6	5dgk:B
19	1ad3:A	446	80	0.1145	0.0583	0.3250	8.0	1ad3:B

[Back]