EIKGILESITGFSIPLDGEYALYPAGRHLRGAIGYIAFNLDLPISSKFLDFDFDDLPICGKIFYPIYGSSVLRNIMARGL
SYKEVIEGKKYRLSIIVKDEKYLNEMEAIIRYILSYGIYLGNKVSKGYGKFKIKEYSIVDILLSDAIIDEKDIVFSKKEI
SSSKFEIIRKRGKAK
The query sequence (length=175) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8z9e:G | 175 | 175 | 1.0000 | 1.0000 | 1.0000 | 1.28e-120 | |
2 | 8yhd:G | 234 | 207 | 0.9943 | 0.7436 | 0.8406 | 1.20e-103 | 8yhe:G, 8z4j:G, 8z4l:G, 8z99:G, 8z9c:G |
3 | 8yk9:D | 165 | 45 | 0.0914 | 0.0970 | 0.3556 | 1.5 | 8yk9:B, 8yk9:C |
4 | 7l7b:C | 1166 | 93 | 0.1486 | 0.0223 | 0.2796 | 1.9 | |
5 | 5u84:B | 353 | 34 | 0.0629 | 0.0312 | 0.3235 | 3.7 | 5u84:A |
6 | 7rcf:A | 290 | 37 | 0.0629 | 0.0379 | 0.2973 | 5.0 | 7rcc:D, 7rcc:A, 7rcc:G, 7rcd:A, 7rce:A, 7rcg:A |
7 | 4c91:A | 811 | 84 | 0.1429 | 0.0308 | 0.2976 | 5.3 | |
8 | 8gyj:B | 428 | 38 | 0.0686 | 0.0280 | 0.3158 | 7.9 | 8gyi:A, 8gyi:B, 8gyj:A |
9 | 7x5j:C | 256 | 53 | 0.1143 | 0.0781 | 0.3774 | 8.5 | 7x5j:D, 7x5j:A, 7x5j:E, 7x5j:B, 7x5j:F |
10 | 5u75:A | 144 | 26 | 0.0686 | 0.0833 | 0.4615 | 9.4 | |
11 | 6tmf:X | 97 | 28 | 0.0743 | 0.1340 | 0.4643 | 9.7 | |
12 | 8qca:A | 805 | 46 | 0.0914 | 0.0199 | 0.3478 | 9.8 | 8qcf:M |