EIKFNIEESKILNGVYIITPNKFSDLRGDIWTAFTDEYLSNLVPNGIKFKHDKFINSHFNVLRGIHGDVKTYKLVTCVYG
EVHQVVVDCRKDSPTYLKWEKFIISPRNQQLILLPPNMGNSHYVSSKEAVYYYKLAYEGEYLDAPDQFTYAWNDERIAID
WPTNSPILSERDILAM
The query sequence (length=176) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8dco:B | 181 | 175 | 0.9773 | 0.9503 | 0.9829 | 1.33e-129 | 8db5:A, 8db5:B, 8db5:C, 8db5:D, 8db5:E, 8db5:F, 8db5:G, 8db5:H, 8dco:A |
2 | 7m15:D | 181 | 174 | 0.8977 | 0.8729 | 0.9080 | 7.88e-120 | 7an4:A, 7an4:B, 7an4:D, 7m14:A, 7m14:B, 7m14:C, 7m14:D, 7m14:E, 7m14:F, 7m15:A, 7m15:B, 7m15:C, 7m15:E, 7m15:F |
3 | 8dcl:A | 185 | 174 | 0.7727 | 0.7351 | 0.7816 | 1.45e-103 | 7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B |
4 | 1dzt:A | 183 | 165 | 0.3125 | 0.3005 | 0.3333 | 1.45e-24 | 1dzt:B |
5 | 6ndr:A | 188 | 162 | 0.3011 | 0.2819 | 0.3272 | 4.30e-20 | 6ndr:B |
6 | 3ryk:A | 175 | 174 | 0.2841 | 0.2857 | 0.2874 | 1.25e-19 | 3ryk:B |
7 | 2ixh:A | 184 | 161 | 0.2727 | 0.2609 | 0.2981 | 1.49e-19 | 2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B |
8 | 6c46:A | 183 | 166 | 0.2955 | 0.2842 | 0.3133 | 1.71e-18 | 6c46:D |
9 | 7pvi:AAA | 199 | 162 | 0.2841 | 0.2513 | 0.3086 | 3.13e-16 | 7pvi:BBB, 7pwb:AAA, 7pwb:BBB |
10 | 1epz:A | 183 | 170 | 0.3068 | 0.2951 | 0.3176 | 4.99e-16 | |
11 | 2ixc:A | 198 | 168 | 0.2614 | 0.2323 | 0.2738 | 4.30e-14 | 2ixc:B, 2ixc:C, 2ixc:D |
12 | 5buv:A | 174 | 177 | 0.3068 | 0.3103 | 0.3051 | 2.24e-13 | 5buv:B |
13 | 1oi6:A | 202 | 173 | 0.2670 | 0.2327 | 0.2717 | 8.62e-11 | 1oi6:B |
14 | 7pwh:AAA | 203 | 165 | 0.2670 | 0.2315 | 0.2848 | 1.08e-09 | |
15 | 4hn1:C | 201 | 165 | 0.2500 | 0.2189 | 0.2667 | 7.33e-06 | 4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D |
16 | 1vli:A | 358 | 114 | 0.1534 | 0.0754 | 0.2368 | 0.15 | |
17 | 8auv:C | 117 | 63 | 0.1080 | 0.1624 | 0.3016 | 0.83 | 8b2l:C1 |
18 | 7cp7:A | 430 | 87 | 0.1193 | 0.0488 | 0.2414 | 3.2 | 7cp6:A, 7cp6:B |
19 | 7rml:A | 281 | 80 | 0.1307 | 0.0819 | 0.2875 | 3.5 | 7rml:B, 7rml:C |
20 | 7pmk:Q | 766 | 31 | 0.0682 | 0.0157 | 0.3871 | 7.3 | 7pmn:Q |
21 | 7s6e:B | 400 | 93 | 0.1307 | 0.0575 | 0.2473 | 7.9 | 7s6e:A |
22 | 4pbg:A | 468 | 50 | 0.0966 | 0.0363 | 0.3400 | 9.7 | 4pbg:B |
23 | 6p2n:A | 748 | 70 | 0.0852 | 0.0201 | 0.2143 | 9.9 |