EFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKMGKGITLSNEEFQTMVDAFK
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4g06:A | 68 | 66 | 0.9851 | 0.9706 | 1.0000 | 7.18e-45 | 6jip:A, 6jiq:A, 5zkl:A |
2 | 2ltt:A | 74 | 62 | 0.6119 | 0.5541 | 0.6613 | 2.29e-25 | 2ltt:B |
3 | 7u2a:B | 442 | 34 | 0.2239 | 0.0339 | 0.4412 | 0.23 | 8ffy:A, 7u2a:A, 7u2b:A |
4 | 1wle:B | 469 | 34 | 0.2239 | 0.0320 | 0.4412 | 0.25 | 8ffy:B, 7tzb:A, 7tzb:B, 7u2b:B, 1wle:A |
5 | 7y82:A | 1341 | 61 | 0.2985 | 0.0149 | 0.3279 | 0.73 | |
6 | 7y84:A | 1242 | 61 | 0.2985 | 0.0161 | 0.3279 | 0.79 | 7x7a:A, 7x7r:A, 7xc7:A, 7y83:A, 7y85:A |
7 | 8d97:A | 1600 | 61 | 0.2985 | 0.0125 | 0.3279 | 0.82 | |
8 | 7y80:A | 1218 | 61 | 0.2985 | 0.0164 | 0.3279 | 0.83 | 8gu6:A |
9 | 6k3c:B | 351 | 44 | 0.1940 | 0.0370 | 0.2955 | 0.99 | |
10 | 8gna:A | 1188 | 45 | 0.2388 | 0.0135 | 0.3556 | 1.1 | |
11 | 8d8n:B | 1256 | 45 | 0.2388 | 0.0127 | 0.3556 | 1.1 | 8d9e:B, 8d9i:B, 7y81:A |
12 | 7y8t:A | 1298 | 45 | 0.2388 | 0.0123 | 0.3556 | 1.1 | 8d9g:B, 7xsq:A, 7xsr:B, 7y8y:A |
13 | 7xss:B | 1282 | 45 | 0.2388 | 0.0125 | 0.3556 | 1.1 | 8d9f:B, 8d9h:B, 7x8a:A, 7xso:A, 7xsp:B, 7xt4:B |
14 | 6eu6:A | 405 | 29 | 0.1493 | 0.0247 | 0.3448 | 1.3 | |
15 | 6qgn:A | 223 | 32 | 0.1642 | 0.0493 | 0.3438 | 2.3 | 6qgn:B, 6qgn:C, 6qgn:D, 5sym:A, 5sym:B |
16 | 5hh3:C | 393 | 67 | 0.2687 | 0.0458 | 0.2687 | 3.3 | 5hh3:A |
17 | 1aqe:A | 110 | 44 | 0.2239 | 0.1364 | 0.3409 | 4.8 | 1czj:A |
18 | 7d4i:3B | 242 | 20 | 0.1194 | 0.0331 | 0.4000 | 4.8 | 7aju:CB, 7d4i:3C, 7d5s:3C, 7d5t:3B, 7d5t:3C, 7d63:3C, 6ke6:3C, 6lqp:3C, 6lqq:3C, 6lqr:3C, 6lqs:3C, 6lqt:3C, 6lqu:3C, 6lqv:3C, 7suk:SD, 5wlc:SD, 6zqd:CA, 6zqd:CB |
19 | 5jyx:B | 109 | 20 | 0.1194 | 0.0734 | 0.4000 | 5.8 | 5jyx:A, 5jyx:E, 5jyx:C, 5jyx:J, 5jyx:D, 5jyx:H, 5jyx:F, 5jyx:O, 5jyx:G, 5jyx:L, 5jyx:I, 5jyx:K, 5jyx:M, 5jyx:N |
20 | 2dq0:A | 447 | 25 | 0.1493 | 0.0224 | 0.4000 | 5.8 | 2dq0:B, 2zr2:A, 2zr2:B |
21 | 5vcm:B | 358 | 37 | 0.1493 | 0.0279 | 0.2703 | 8.2 | 5vcm:A, 5vcs:A |
22 | 7o0t:A | 354 | 46 | 0.2239 | 0.0424 | 0.3261 | 8.9 | 7o0t:B, 7o0t:C, 7o0t:D |