EFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNISVFKQYFFETKCRDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQA
AWRFIRIDTACVCVLSR
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4zbn:B | 99 | 97 | 0.9485 | 0.9293 | 0.9485 | 3.13e-60 | |
2 | 1btg:B | 109 | 104 | 0.9381 | 0.8349 | 0.8750 | 7.75e-60 | 1btg:C, 4eax:A, 4eax:B, 4eax:D, 4xpj:A, 4xpj:B, 4zbn:A |
3 | 4gba:B | 206 | 56 | 0.1443 | 0.0680 | 0.2500 | 2.6 | 4gba:A |
4 | 5j7o:F | 622 | 77 | 0.1856 | 0.0289 | 0.2338 | 4.1 | 5j7o:A, 5j7o:B, 5j7o:C, 5j7o:D, 5j7o:E, 5j7u:A, 5j7u:B, 5j7u:C, 5j7u:D, 5j7u:E, 5j7u:F, 5j7u:G, 5j7u:H, 5j7u:I, 5j7u:J, 5j7u:K, 5j7u:L |
5 | 6hiv:CP | 180 | 41 | 0.1443 | 0.0778 | 0.3415 | 4.2 | 6hiw:CP, 6hiy:CP, 7pua:CP, 7pub:CP, 6sga:CP, 6sgb:CP |
6 | 7aor:j | 180 | 41 | 0.1340 | 0.0722 | 0.3171 | 7.4 | |
7 | 4bbo:A | 113 | 32 | 0.1134 | 0.0973 | 0.3438 | 8.5 | 4bbo:B, 4bbo:C, 4bbo:D |
8 | 5gkp:B | 239 | 29 | 0.1134 | 0.0460 | 0.3793 | 8.7 | 5gkp:A |