BioLiP

>protein
EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPL
PKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWGEE
LN

The query sequence (length=162) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4xls:M	162	162	1.0000	1.0000	1.0000	6.18e-116	4xlr:M, 4xlr:N, 4xls:N
2	8hvr:H	158	154	0.2469	0.2532	0.2597	1.21e-14	8jke:H
3	6edt:M	159	154	0.2469	0.2516	0.2597	1.65e-13	6ee8:M, 6eec:M, 7kif:M, 7kin:M, 6vvx:M, 6vvy:M, 6vvz:M, 6vw0:M
4	7kim:M	135	105	0.1667	0.2000	0.2571	1.01e-05
5	6x2f:A	1144	68	0.1235	0.0175	0.2941	0.064	7ssg:A, 6x26:A, 6x2n:A, 6x43:A, 6x4w:A, 6x4y:A, 6x50:A
6	6xeo:A	1118	66	0.1235	0.0179	0.3030	0.065
7	6acx:A	1175	47	0.0926	0.0128	0.3191	0.084	6acx:B
8	8iff:A	868	113	0.1728	0.0323	0.2478	1.1	8f5z:B, 8f5z:A, 8iff:B, 8isj:A, 8isj:B
9	2d09:A	404	31	0.0926	0.0371	0.4839	4.0	2d0e:A, 5de9:A, 5de9:B, 1s1f:A, 1se6:A, 1se6:B, 1t93:A, 3tzo:A, 3tzo:B
10	3u33:A	540	49	0.1173	0.0352	0.3878	5.0	3djl:A, 3u33:B, 3u33:C, 3u33:D, 3u33:E, 3u33:F, 3u33:G, 3u33:H, 3u33:I, 3u33:J, 3u33:K, 3u33:L
11	4dy7:F	378	29	0.0617	0.0265	0.3448	5.2
12	5ysw:A	374	29	0.0802	0.0348	0.4483	6.3	5ysm:A
13	8aw5:A	266	23	0.0617	0.0376	0.4348	8.7	8aw5:B, 8aw5:C
14	7xp7:B	376	27	0.0679	0.0293	0.4074	9.7	7xp7:A, 7xp7:C, 7xp7:D

[Back]