BioLiP

>protein
EFNVVPYYSWFSGITQFQKGKEFEFVEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGQLLPRWYFYYLGTGPHAKDQY
GTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGS

The query sequence (length=133) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4kxj:A	135	135	1.0000	0.9852	0.9852	1.48e-94	4li4:A, 4lm7:A, 4lm9:A, 4lmc:A, 4lmt:A
2	7acs:A	140	129	0.4586	0.4357	0.4729	2.07e-30	7act:A, 8iv3:D, 8j6x:A, 8j6x:D, 6vyo:A, 6vyo:B, 6vyo:C, 6vyo:D, 6wkp:B, 6wkp:C, 6wkp:D, 7xwz:A, 7xwz:B, 7xx1:A, 7xx1:B, 7xx1:C, 7xx1:D
3	6lz8:B	130	127	0.4060	0.4154	0.4252	5.54e-27	6kl5:A, 6kl6:B
4	6lz8:D	112	124	0.3684	0.4375	0.3952	2.65e-22	7dyd:D, 6kl5:C, 6kl6:D, 6lnn:D, 6lz6:D
5	6wkp:A	103	121	0.3759	0.4854	0.4132	6.08e-21
6	8em7:A	4378	23	0.0827	0.0025	0.4783	1.6	8em7:B, 8jut:A, 8jut:B, 8juu:B, 8juu:A, 8jx8:B, 8jx8:A, 8jx9:B, 8jxa:A, 8jxb:A, 8jxd:A, 8jxe:A, 8jxe:B, 8jxf:B, 8jxg:A, 8jxh:A, 8jxi:B
7	8uw3:A	1265	49	0.1053	0.0111	0.2857	1.7	7n8s:A, 7n94:A, 7n94:B, 8sp5:A, 8sp5:B, 8sp7:A, 8sxt:A, 8sxu:A, 1vyb:B
8	8em4:A	3818	23	0.0827	0.0029	0.4783	1.8	8em4:B
9	5oe3:A	394	53	0.1504	0.0508	0.3774	2.9	5oe3:B, 5oe3:C, 5oe3:D, 5oe4:A, 5oe4:B, 5oe5:A, 5oe6:A, 5oe6:B, 5oe6:C, 5oe6:D
10	5k8e:A	473	35	0.0977	0.0275	0.3714	3.4	5l6f:A, 5l6g:A
11	2ixu:A	338	64	0.1128	0.0444	0.2344	6.0	2ixv:A, 2j8f:A, 2j8g:A, 1oba:A
12	4wv3:B	518	85	0.2030	0.0521	0.3176	6.1	4wv3:A
13	2itm:A	476	58	0.1429	0.0399	0.3276	6.3	2itm:B
14	3c5m:B	378	94	0.1504	0.0529	0.2128	7.8	3c5m:A, 3c5m:C
15	5wu3:B	485	47	0.1128	0.0309	0.3191	8.5	5wu2:A, 5wu2:B, 5wu3:A, 5wu4:A, 5wu4:B
16	6azq:G	226	58	0.1278	0.0752	0.2931	9.3	6azq:H, 6azq:A, 6azq:B, 6azq:C, 6azq:D, 6azq:E, 6azs:B, 6azs:D

[Back]