BioLiP

>protein
EFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALA
YGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGW
PLAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPG

The query sequence (length=207) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6edg:A	213	207	0.9758	0.9484	0.9758	1.79e-144	1aer:A, 1aer:B, 3b78:B, 3b78:D, 3b78:F, 3b82:B, 3b82:D, 3b82:F, 3b8h:B, 3b8h:D, 3b8h:F, 1dma:A, 1dma:B, 1xk9:A, 1xk9:B, 2zit:B, 2zit:D, 2zit:F, 1zm4:B, 1zm4:D, 1zm4:F, 1zm9:B, 1zm9:D, 1zm9:F
2	3q9o:A	605	199	0.3961	0.1355	0.4121	8.59e-37	3ess:A, 3ki0:A, 3ki1:A, 3ki2:A, 3ki3:A, 3ki4:A, 3ki5:A, 3ki6:A, 3ki7:A, 3ny6:A, 2q6m:A
3	9biw:B	528	135	0.1836	0.0720	0.2815	0.079	9biw:A
4	1ddt:A	523	135	0.1787	0.0707	0.2741	0.17	4ae1:A, 4ae1:B, 1dtp:A, 1f0l:A, 1f0l:B, 8g0g:A, 8g0g:B, 1mdt:A, 1mdt:B, 7o4w:A, 1tox:A, 1tox:B
5	3c49:A	357	63	0.0821	0.0476	0.2698	1.4	3c4h:A, 3ce0:A, 3fhb:A, 4gv0:A, 4gv2:A, 4gv4:A, 4l6z:A, 4l70:A, 4l7l:A, 4l7n:A, 4l7o:A, 4l7p:A, 4l7r:A, 4l7u:A
6	6hxs:A	248	52	0.0725	0.0605	0.2885	1.5	4f0d:A, 6hxr:A, 6hxr:B, 6hxs:B, 6hxs:C, 6w65:A, 6w65:B, 6w65:C
7	6vvo:A	448	79	0.0966	0.0446	0.2532	2.6
8	7dsu:B	420	64	0.0966	0.0476	0.3125	5.5	7dsu:A

[Back]