BioLiP

>protein
EFDSFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQQSGTSLTNCPGSPFDITKISHLQSQLNTLWPTVLRANNQQ
FWSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPHAAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKV
SYLVEVVACFAQDGSTLIDCTRDTCGANFIF

The query sequence (length=191) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1v9h:A	193	191	0.9895	0.9793	0.9895	1.01e-142	1j1f:A, 1j1g:A, 1uca:A, 1ucc:A, 1ucd:A
2	1iyb:A	208	200	0.3927	0.3606	0.3750	3.10e-41	1iyb:B
3	1vcz:A	204	187	0.3403	0.3186	0.3476	6.83e-30	1vd1:A, 1vd3:A
4	1sgl:A	206	188	0.2723	0.2524	0.2766	1.00e-12
5	3d3z:A	238	141	0.2251	0.1807	0.3050	2.13e-07
6	5u6k:E	191	87	0.1204	0.1204	0.2644	2.6	5u6k:A, 5u6k:B, 5u6k:C, 5u6k:D
7	4dw4:B	163	63	0.0838	0.0982	0.2540	2.6	4dvl:A, 4dvl:B, 4dvn:B, 4dvn:A, 4dw3:A, 4dw3:B, 4dw4:A, 4dw5:A, 4dw5:B, 4dw7:A, 4dw7:B, 4dwa:A, 4dwa:B, 4dwc:A
8	8c54:A	482	88	0.1204	0.0477	0.2614	4.4	8c54:B, 8c54:C, 8c54:D
9	8thc:A	479	49	0.0733	0.0292	0.2857	5.3	8thb:A, 8thd:A
10	7vmx:A	260	40	0.0733	0.0538	0.3500	5.4
11	6d4b:A	361	43	0.0838	0.0443	0.3721	9.1	6d4b:B, 6d4c:A, 6d4c:B, 5dn9:A, 5dn9:B
12	5juy:B	1234	44	0.0681	0.0105	0.2955	9.3	1cy5:A, 3j2t:A, 3j2t:B, 3j2t:C, 3j2t:D, 3j2t:E, 3j2t:F, 3j2t:G, 3jbt:A, 3jbt:C, 3jbt:E, 3jbt:G, 3jbt:I, 3jbt:K, 3jbt:M, 5juy:A, 5juy:C, 5juy:D, 5juy:E, 5juy:F, 5juy:G, 2p1h:A, 5wve:A, 5wve:C, 5wve:E, 5wve:G, 5wve:I, 5wve:K, 5wve:M, 1z6t:A, 1z6t:B, 1z6t:C, 1z6t:D

[Back]