EEWRGEVVHLSWSPRAFLLKNFLSDEECDYIVEKARPKMVKSSVVDNESGKSVDSEIRTSTGTWFAKGEDSVISKIEKRV
AQVTMIPLENHEGLQVLHYHDGQKYEPHYDYFHDPVNAGPEHGGQRVVTMLMYLTTVEEGGETVLPNAEQKVTGDGWSEC
AKRGLAVKPIKGDALMFYSLKPDGSNDPASLHGSCPTLKGDKWSATKWIHVAPIGG
The query sequence (length=216) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2jig:A | 216 | 216 | 1.0000 | 1.0000 | 1.0000 | 1.98e-163 | 3gze:A, 3gze:C |
2 | 2jig:B | 195 | 216 | 0.9028 | 1.0000 | 0.9028 | 1.34e-141 | 3gze:B, 3gze:D |
3 | 5v7y:A | 207 | 197 | 0.3472 | 0.3623 | 0.3807 | 1.15e-38 | 5hv0:A, 5hv0:B, 5hv4:A, 5iav:A, 5iav:B, 5iax:A, 5iax:B, 5v7y:B, 5v7y:D, 5v7y:C |
4 | 6tp5:A | 370 | 201 | 0.3102 | 0.1811 | 0.3333 | 5.32e-20 | 6tp5:B |
5 | 6tp5:A | 370 | 36 | 0.0648 | 0.0378 | 0.3889 | 0.60 | 6tp5:B |
6 | 5c5u:B | 190 | 202 | 0.2870 | 0.3263 | 0.3069 | 3.79e-16 | 5c5t:A, 5c5t:B, 5c5u:A |
7 | 6w4q:D | 755 | 193 | 0.2407 | 0.0689 | 0.2694 | 0.71 | 5w6p:A, 5w6p:B, 5w6p:C, 5w6p:D, 5w6p:E, 5w6p:F, 5w6s:A |
8 | 3ggl:A | 161 | 54 | 0.0880 | 0.1180 | 0.3519 | 6.5 | 6oe2:A |
9 | 3oa8:A | 229 | 39 | 0.0509 | 0.0480 | 0.2821 | 6.7 | 3oa8:C, 3oa8:E, 3ocd:A, 3ocd:C |
10 | 8ajk:B | 447 | 32 | 0.0509 | 0.0246 | 0.3438 | 9.3 | 8ajj:C, 8ajj:A, 8ajj:B, 8ajj:D, 8ajk:A |
11 | 5xc3:A | 168 | 42 | 0.0694 | 0.0893 | 0.3571 | 9.5 | 5xc5:A |