EEVKPVAPETALIEARMRNIQTQVKMIGSTNRMFAGMYSGKVQGIMIGLAFTLTLGILLLV
The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8q3v:A | 61 | 61 | 1.0000 | 1.0000 | 1.0000 | 5.46e-39 | 8q3v:a, 8q3v:Q, 8q54:A, 8q54:a, 8q54:Q |
| 2 | 8q3v:F | 67 | 48 | 0.2295 | 0.2090 | 0.2917 | 0.015 | 8q3v:V, 8q3v:f, 8q54:V, 8q54:F, 8q54:f |
| 3 | 5gm2:K | 267 | 27 | 0.1967 | 0.0449 | 0.4444 | 3.3 |
umich.edu