EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNG
KGEWTCKPI
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2rkz:C | 90 | 89 | 1.0000 | 0.9889 | 1.0000 | 6.49e-63 | 3cal:A, 3cal:C, 4pz5:A, 2rkz:A, 2rkz:B, 2rkz:D, 2rkz:E, 2rkz:F, 3zrz:A, 3zrz:B |
2 | 1o9a:A | 93 | 47 | 0.5281 | 0.5054 | 1.0000 | 9.08e-29 | |
3 | 1o9a:A | 93 | 89 | 0.3034 | 0.2903 | 0.3034 | 3.14e-06 | |
4 | 2rky:C | 92 | 89 | 0.4944 | 0.4783 | 0.4944 | 9.04e-24 | 2rky:A, 2rl0:A, 2rl0:B, 2rl0:D, 2rl0:F, 2rl0:K |
5 | 2rl0:I | 79 | 89 | 0.4719 | 0.5316 | 0.4719 | 1.91e-20 | |
6 | 3ejh:A | 91 | 81 | 0.3596 | 0.3516 | 0.3951 | 1.28e-13 | 3ejh:B, 3gxe:B, 3gxe:A |
7 | 3ejh:A | 91 | 41 | 0.1573 | 0.1538 | 0.3415 | 0.045 | 3ejh:B, 3gxe:B, 3gxe:A |
8 | 3m7p:A | 301 | 85 | 0.3146 | 0.0930 | 0.3294 | 9.09e-08 | |
9 | 3m7p:A | 301 | 81 | 0.3146 | 0.0930 | 0.3457 | 8.34e-07 | |
10 | 3m7p:A | 301 | 41 | 0.1573 | 0.0465 | 0.3415 | 0.11 | |
11 | 7elh:B | 1264 | 58 | 0.1798 | 0.0127 | 0.2759 | 0.48 | 1mwh:A, 1n1h:A, 1n35:A, 1n38:A, 1uon:A, 7yed:R, 7yfe:R |
12 | 7og2:A | 622 | 84 | 0.2360 | 0.0338 | 0.2500 | 3.3 | 7og2:B |
13 | 4bed:A | 1664 | 23 | 0.1011 | 0.0054 | 0.3913 | 5.7 | 4bed:C |
14 | 3c4n:A | 359 | 62 | 0.2022 | 0.0501 | 0.2903 | 8.9 | 3c4n:B |