EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHEGYMLECVCLGNGKG
EWTCKPI
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2rkz:C | 90 | 89 | 1.0000 | 0.9667 | 0.9775 | 1.00e-59 | 3cal:A, 3cal:C, 4pz5:A, 2rkz:A, 2rkz:B, 2rkz:D, 2rkz:E, 2rkz:F, 3zrz:A, 3zrz:B |
2 | 1o9a:A | 93 | 47 | 0.5402 | 0.5054 | 1.0000 | 9.26e-29 | |
3 | 1o9a:A | 93 | 87 | 0.3103 | 0.2903 | 0.3103 | 6.09e-08 | |
4 | 2rky:C | 92 | 88 | 0.5057 | 0.4783 | 0.5000 | 1.89e-24 | 2rky:A, 2rl0:A, 2rl0:B, 2rl0:D, 2rl0:F, 2rl0:K |
5 | 2rl0:I | 79 | 87 | 0.4828 | 0.5316 | 0.4828 | 8.62e-21 | |
6 | 3ejh:A | 91 | 79 | 0.3678 | 0.3516 | 0.4051 | 3.07e-15 | 3ejh:B, 3gxe:B, 3gxe:A |
7 | 3ejh:A | 91 | 41 | 0.1609 | 0.1538 | 0.3415 | 0.041 | 3ejh:B, 3gxe:B, 3gxe:A |
8 | 3m7p:A | 301 | 79 | 0.3218 | 0.0930 | 0.3544 | 2.94e-08 | |
9 | 3m7p:A | 301 | 84 | 0.3218 | 0.0930 | 0.3333 | 6.32e-08 | |
10 | 3m7p:A | 301 | 41 | 0.1609 | 0.0465 | 0.3415 | 0.11 | |
11 | 3m7p:A | 301 | 29 | 0.1149 | 0.0332 | 0.3448 | 5.8 | |
12 | 7elh:B | 1264 | 57 | 0.1839 | 0.0127 | 0.2807 | 0.73 | 1mwh:A, 1n1h:A, 1n35:A, 1n38:A, 1uon:A, 7yed:R, 7yfe:R |
13 | 5bz4:K | 400 | 48 | 0.1724 | 0.0375 | 0.3125 | 3.9 | 5bz4:B, 5bz4:D, 5bz4:F, 5bz4:H |
14 | 4bed:A | 1664 | 23 | 0.1034 | 0.0054 | 0.3913 | 5.4 | 4bed:C |
15 | 7og2:A | 622 | 84 | 0.2414 | 0.0338 | 0.2500 | 7.8 | 7og2:B |