EEQKIKIYVTKRRFGKLMTIIEGFDTSVIDLKELAKKLKDICACGGTVKDNTIELQGDHRKKVAEELVKMGFSRDSIEIR
The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5jb3:1 | 83 | 80 | 1.0000 | 0.9639 | 1.0000 | 4.60e-53 | 5jbh:1 |
2 | 5zcy:A | 83 | 79 | 0.5250 | 0.5060 | 0.5316 | 2.12e-25 | |
3 | 6gsm:m | 96 | 82 | 0.3750 | 0.3125 | 0.3659 | 3.26e-05 | 8cah:m, 6gsn:m, 3j80:j, 3j81:m, 3jam:j, 3jap:m, 4uer:F, 6zce:m |
4 | 7a09:Z | 110 | 79 | 0.3500 | 0.2545 | 0.3544 | 2.95e-04 | 9bln:W, 4kzx:l, 4kzy:l, 8pj1:p, 8ppk:p, 8ppl:Ip, 7qp6:p, 8xxn:C1, 6ybw:p, 6zmw:p, 6zp4:Z, 6zvj:N |
5 | 4bts:AF | 89 | 85 | 0.3125 | 0.2809 | 0.2941 | 7.66e-04 | 4bts:BF, 4bts:CF, 4bts:DF, 4v5o:AF, 4v5o:BF |
6 | 8s8f:m | 77 | 69 | 0.3250 | 0.3377 | 0.3768 | 8.94e-04 | 8s8i:m |
7 | 7ase:V | 97 | 73 | 0.2250 | 0.1856 | 0.2466 | 0.004 | |
8 | 4ayx:A | 571 | 36 | 0.1875 | 0.0263 | 0.4167 | 0.54 | 4ayt:A, 4ayw:A, 7y48:B, 3zdq:A |
9 | 6vpq:A | 87 | 58 | 0.2500 | 0.2299 | 0.3448 | 0.56 | 6vpq:B, 6vpq:C, 6vpq:E, 6vpq:F, 5vyc:l1, 5vyc:l2, 5vyc:l3, 5vyc:l4, 5vyc:l5, 5vyc:l6 |
10 | 7w3u:A | 343 | 55 | 0.1750 | 0.0408 | 0.2545 | 0.90 | 7w3r:A, 7w3u:B, 7w3u:C |
11 | 4qsh:C | 1081 | 52 | 0.2000 | 0.0148 | 0.3077 | 5.4 | 4qsh:A, 4qsh:D, 4qsh:B, 4qsk:A, 4qsk:B |
12 | 1t10:A | 556 | 22 | 0.1375 | 0.0198 | 0.5000 | 7.1 | |
13 | 8tci:A | 283 | 50 | 0.1750 | 0.0495 | 0.2800 | 7.4 | 8tci:D |