EELSGTKVSAPYYTLEYHNAMVVGTEEAGSAGVRVLYLYPTHKSLKPCPFFLEGKCRFKENCRFSHGQVVSLDELRPFQD
PDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPP
The query sequence (length=136) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4ii1:B | 139 | 139 | 1.0000 | 0.9784 | 0.9784 | 4.62e-97 | 4ii1:A, 4ii1:C, 4ii1:D |
2 | 8y6o:V | 101 | 31 | 0.1176 | 0.1584 | 0.5161 | 0.009 | |
3 | 8dil:A | 175 | 117 | 0.2206 | 0.1714 | 0.2564 | 0.14 | 8dil:B, 8dil:C, 8dil:D, 8dil:E, 8dil:F |
4 | 7abi:P | 237 | 77 | 0.1397 | 0.0802 | 0.2468 | 0.24 | 7aav:P, 7abg:P |
5 | 8ch6:U | 295 | 102 | 0.1691 | 0.0780 | 0.2255 | 0.43 | 7a5p:P, 8c6j:M, 6ff4:P, 6ff7:P, 9fmd:O, 8i0p:O, 8i0r:O, 8i0s:O, 8i0t:O, 8i0u:O, 8i0v:O, 8i0w:O, 6icz:O, 6id0:O, 6id1:O, 5mqf:P, 6qdv:M, 7qtt:U, 8ro2:O, 7w59:O, 7w5a:O, 7w5b:O, 5xjc:O, 5yzg:O, 5z56:O, 5z57:O, 6zym:P |
6 | 1m9o:A | 40 | 23 | 0.0809 | 0.2750 | 0.4783 | 1.3 | |
7 | 3bm1:A | 177 | 81 | 0.1691 | 0.1299 | 0.2840 | 1.4 | 3bm1:B |
8 | 3mco:A | 397 | 69 | 0.1471 | 0.0504 | 0.2899 | 1.5 | 3mcn:B, 3mco:B |
9 | 7jgr:D | 441 | 58 | 0.1471 | 0.0454 | 0.3448 | 1.6 | 7jgs:D, 7jk2:D, 7jk3:D, 7jk4:D, 7jk5:D, 7jk6:D |
10 | 7mp9:A | 414 | 64 | 0.1544 | 0.0507 | 0.3281 | 2.1 | 8uct:A, 8udc:A |
11 | 6uej:A | 212 | 82 | 0.1544 | 0.0991 | 0.2561 | 2.3 | 6uei:A |
12 | 4cs7:C | 172 | 21 | 0.0588 | 0.0465 | 0.3810 | 2.3 | 4cs7:A, 4cs7:B, 4cs7:E, 4cs8:A, 4cs8:B, 4cs8:C, 4cs8:E, 4cs9:A, 4cs9:B, 4cs9:C, 4cs9:E, 4csa:C, 4csa:A, 4csa:B, 4csa:E |
13 | 3omc:A | 217 | 23 | 0.0735 | 0.0461 | 0.4348 | 3.1 | 5m9o:A, 3omc:B, 3omg:A, 3omg:B |
14 | 5gpc:A | 190 | 113 | 0.1985 | 0.1421 | 0.2389 | 3.1 | 5gpc:B, 5gpc:C, 5gpc:D |
15 | 6n9l:A | 625 | 54 | 0.1029 | 0.0224 | 0.2593 | 3.7 | |
16 | 3dpm:A | 522 | 54 | 0.1103 | 0.0287 | 0.2778 | 4.4 | 3dpm:B |
17 | 8ro0:O | 342 | 43 | 0.0956 | 0.0380 | 0.3023 | 4.6 | 8ro1:O |
18 | 1rgo:A | 70 | 28 | 0.0882 | 0.1714 | 0.4286 | 6.9 | |
19 | 4c3b:C | 178 | 21 | 0.0662 | 0.0506 | 0.4286 | 7.0 | 4c3b:A, 4c3b:B, 4c3b:D, 4c3b:E, 4c3b:F, 4c3b:G, 4c3b:H, 4c3b:I, 4c3b:J, 4c3b:K, 4c3b:L, 4c3b:M, 4c3b:N, 4c3b:O, 4c3b:P, 4c3e:A, 4c3e:B, 4c3e:C, 4c3e:D, 4c3e:E, 4c3e:F, 4c3e:G, 4c3e:H, 4c3e:I, 4c3e:J, 4c3e:K, 4c3e:L, 4c3e:M, 4c3e:N, 4c3e:O, 4c3e:P, 6g0y:F, 6g0y:E, 6g0y:A, 6g0y:C, 6pzq:B, 6pzq:D |
20 | 2j5z:A | 214 | 86 | 0.1618 | 0.1028 | 0.2558 | 7.5 | 2j5z:B, 2j5z:C, 2j60:A, 2j60:B, 2j60:C, 2j64:A, 2j64:B, 2j64:C |
21 | 1zca:A | 318 | 47 | 0.1029 | 0.0440 | 0.2979 | 7.7 | 1zca:B |
22 | 6pzq:A | 157 | 21 | 0.0662 | 0.0573 | 0.4286 | 7.8 | 6pzq:C |