EEKYYMDADLLREIKQHLKQQQEGLSHLMSIIKDDLEDIKLV
The query sequence (length=42) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4j3h:A | 42 | 42 | 1.0000 | 1.0000 | 1.0000 | 1.72e-23 | 4j3h:B |
2 | 6rft:A | 406 | 28 | 0.2857 | 0.0296 | 0.4286 | 0.090 | 6rft:B, 6rft:C, 6rft:D, 6rft:E, 6rft:F, 6rfx:D, 6rfx:A, 6rfx:B, 6rfx:C, 6rfx:E |
3 | 3fkq:A | 354 | 23 | 0.2381 | 0.0282 | 0.4348 | 1.1 | |
4 | 8d8k:T | 92 | 36 | 0.2381 | 0.1087 | 0.2778 | 6.6 | 8d8l:T, 5mrc:TT, 5mre:TT, 5mrf:TT, 8om2:T, 8om3:T, 8om4:T |
5 | 3eh1:A | 737 | 25 | 0.2381 | 0.0136 | 0.4000 | 9.6 |