BioLiP

>protein
EEIFTLQVRGRERYEILKKLNDSLELSDVVPASDAEKY

The query sequence (length=38) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4d1l:F	38	38	1.0000	1.0000	1.0000	1.02e-21	4cz5:C, 4cz6:D
2	2wtt:L	46	35	0.5000	0.4130	0.5429	3.38e-07	2wqj:K, 2wqj:Z, 2wtt:N, 2wtt:O, 2wtt:P
3	4mzr:A	234	27	0.4211	0.0684	0.5926	1.69e-05	4mzr:B, 4mzr:C, 4mzr:D, 3q01:A, 3q01:B, 3q05:A, 3q05:C, 3q05:B, 3q05:D, 3q06:A, 3q06:C, 3q06:D, 3q06:B, 3ts8:A, 3ts8:B, 3ts8:C, 3ts8:D
4	2wqj:C	32	29	0.4474	0.5312	0.5862	2.13e-05
5	7bwn:J	280	27	0.4211	0.0571	0.5926	2.20e-05	7bwn:O, 7bwn:C, 7bwn:M, 4gf6:B, 4w74:A, 4w74:B, 4w74:H, 4w74:C, 4w74:D, 4w74:E, 4w76:A, 4w76:B, 4w77:A, 4w77:B, 4w7a:A, 4w7a:B, 4w7c:B, 4w7d:A, 4w7f:A, 4w7r:A, 4w7r:B, 4w7r:C, 4w7r:D
6	4nen:A	1063	18	0.2632	0.0094	0.5556	1.1
7	4neh:A	1084	18	0.2632	0.0092	0.5556	1.1	5es4:A, 3k6s:A, 3k71:G
8	5jc7:A	641	21	0.2632	0.0156	0.4762	2.7
9	4dz6:A	168	31	0.2632	0.0595	0.3226	2.8	4dz6:B, 4dz6:C, 4dz6:D, 4dz6:E, 4dz6:F
10	5jc3:A	668	21	0.2632	0.0150	0.4762	2.9	5jc3:B, 5jc7:B, 5jcf:A, 5jcf:B, 5jch:A, 5jch:B
11	8a22:AO	377	27	0.2632	0.0265	0.3704	3.7	8apn:AO, 8apo:AO
12	8jhz:A	2615	21	0.2105	0.0031	0.3810	7.8
13	1o7l:B	256	27	0.2895	0.0430	0.4074	8.1	1h9r:A, 1h9r:B, 1h9s:A, 1h9s:B, 1o7l:A, 1o7l:C, 1o7l:D
14	1w5s:B	396	21	0.2632	0.0253	0.4762	9.8	1w5s:A, 1w5t:A, 1w5t:B, 1w5t:C

[Back]