EEEQYFKTNPKPAYIDELIKDAKEFIDLQYSLKRNKIVLITSGGTTVPLENNTVRFIDNFSAGTRGASSAEQFLANGYSV
The query sequence (length=309) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
6ai9:B |
311 |
309 |
1.0000 |
0.9936 |
1.0000 |
0.0 |
6ai9:A, 6aik:A, 6aik:B, 6aim:A, 6aim:B, 6aip:A, 6aip:B |
2 |
7edz:B |
306 |
280 |
0.3657 |
0.3693 |
0.4036 |
1.11e-59 |
7edz:D, 7edz:C, 7edz:A |
3 |
8owr:B |
229 |
46 |
0.0583 |
0.0786 |
0.3913 |
0.28 |
6th2:B, 6th2:D |
4 |
6tgv:C |
389 |
56 |
0.0680 |
0.0540 |
0.3750 |
0.44 |
8ow5:A, 8ow5:B, 8ow5:C, 8ow5:D, 8owb:A, 8owb:B, 8owb:C, 8owb:D, 8owp:A, 8owp:B, 8owp:C, 8owp:D, 8owq:A, 8owq:B, 8owq:C, 8owq:D, 8owr:A, 8owr:C, 8owr:D, 4qji:A, 4qji:B, 6tgv:A, 6tgv:B, 6tgv:D, 6th2:A, 6th2:C, 6thc:A, 6thc:B, 6thc:C, 6thc:D |
5 |
3db7:A |
127 |
97 |
0.0680 |
0.1654 |
0.2165 |
0.55 |
|
6 |
2yri:A |
352 |
120 |
0.0906 |
0.0795 |
0.2333 |
0.72 |
2yri:B, 2yrr:A, 2yrr:B |
7 |
4nes:A |
362 |
117 |
0.0906 |
0.0773 |
0.2393 |
0.75 |
|
8 |
3vx4:D |
240 |
67 |
0.0583 |
0.0750 |
0.2687 |
3.4 |
3vx4:A |
9 |
8h67:E |
299 |
101 |
0.0841 |
0.0870 |
0.2574 |
6.2 |
8h67:F, 8h67:G, 8h67:H, 8h67:J, 8h67:I, 8h7q:C, 8h7q:E, 8h7q:F, 8h7q:G, 8h7q:H, 8h7q:I, 8ip0:B, 8ip0:C, 8ip0:D, 8ip0:N, 8ip0:H, 8ip0:I |
10 |
7ojl:L |
1498 |
141 |
0.1036 |
0.0214 |
0.2270 |
6.4 |
|
11 |
2irf:H |
109 |
51 |
0.0388 |
0.1101 |
0.2353 |
7.2 |
2irf:I, 2irf:J, 2irf:K, 2irf:L, 2irf:G |
12 |
3t0u:B |
668 |
58 |
0.0453 |
0.0210 |
0.2414 |
8.1 |
1a2v:A, 1a2v:B, 1a2v:C, 1a2v:F, 1a2v:E, 1a2v:D, 1ekm:A, 1ekm:B, 1ekm:C, 4ev2:A, 4ev2:B, 4ev2:C, 4ev2:D, 4ev2:E, 4ev2:F, 4ev5:A, 4ev5:B, 4ev5:C, 4ev5:D, 4ev5:E, 4ev5:F, 4kfd:A, 4kfd:B, 4kfd:C, 4kfd:D, 4kfd:E, 4kfd:F, 4kfe:A, 4kfe:B, 4kfe:C, 4kfe:D, 4kfe:E, 4kfe:F, 4kff:A, 4kff:B, 4kff:C, 3n9h:A, 3n9h:B, 3n9h:C, 3n9h:D, 3n9h:E, 3n9h:F, 3nbb:A, 3nbb:B, 3nbb:C, 3nbb:D, 3nbb:E, 3nbb:F, 3nbj:A, 3nbj:B, 3nbj:C, 3nbj:D, 3nbj:E, 3nbj:F, 2oov:A, 2oov:B, 2oov:C, 2oov:D, 2oov:E, 2oov:F, 2oqe:A, 2oqe:B, 2oqe:C, 2oqe:D, 2oqe:E, 2oqe:F, 3sxx:A, 3sxx:B, 3sxx:C, 3sxx:D, 3sxx:E, 3sxx:F, 3t0u:A, 3t0u:C |