Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
EDTGVRVELAEEDHGRKSTIALRLWVEDPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQW
RRE

The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6fbk:A 83 83 1.0000 1.0000 1.0000 6.22e-56
2 5odc:E 298 36 0.1807 0.0503 0.4167 0.029 5odc:K, 5odh:E, 5odh:K, 5odi:E, 5odi:K, 5odq:E, 5odq:K, 5odr:E, 5odr:K
3 2v3s:B 96 49 0.1928 0.1667 0.3265 0.30 2v3s:A
4 2ix1:A 643 22 0.1446 0.0187 0.5455 0.68 2id0:A, 2id0:B, 2id0:C, 2id0:D, 2ix0:A
5 7l0o:A 479 37 0.1446 0.0251 0.3243 0.93 7l0o:B, 2woy:A, 2wqs:A, 2wza:A
6 6vfv:A 222 56 0.1807 0.0676 0.2679 5.9
7 4tsh:B 485 43 0.1446 0.0247 0.2791 6.3
8 8abv:A 244 22 0.1325 0.0451 0.5000 6.5 8abw:A
9 6e3f:A 497 43 0.1446 0.0241 0.2791 7.5 3opu:A, 3opu:B, 3opu:C, 3opu:D, 3opu:E, 3opu:F, 3qe5:A, 3qe5:B
10 6kbh:A 765 52 0.1566 0.0170 0.2500 9.0
11 4hi0:E 196 41 0.1807 0.0765 0.3659 9.3 4hi0:F

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218