EDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILSTYLGR
The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6cf2:F | 57 | 57 | 1.0000 | 1.0000 | 1.0000 | 5.36e-36 | 4pmi:B, 4pmi:C |
2 | 3apt:A | 292 | 23 | 0.2105 | 0.0411 | 0.5217 | 2.6 | 3apy:A, 3apy:B, 3apy:C, 3apy:D, 3apy:E, 3apy:F, 3apy:G, 3apy:H, 8eac:A, 7th4:A, 7th4:B, 7th5:A, 7th5:B, 1v93:A |
3 | 1kny:A | 253 | 17 | 0.1579 | 0.0356 | 0.5294 | 5.0 | 1kny:B, 6nmk:A, 6nmk:B, 6nml:A, 6nml:B, 6nmm:A, 6nmm:B, 6nmm:C, 6nmm:D, 6nmn:A, 6nmn:B, 6p01:B, 6p04:A, 6p04:B, 6p06:A, 6p06:B, 6p08:A, 6p08:D, 6un8:A, 6un8:B |
4 | 4g56:A | 617 | 21 | 0.1404 | 0.0130 | 0.3810 | 6.6 | 4g56:C |
5 | 6pbd:B | 331 | 27 | 0.1754 | 0.0302 | 0.3704 | 9.6 | |
6 | 6pbd:A | 350 | 27 | 0.1754 | 0.0286 | 0.3704 | 9.7 |