ECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSEGSDLTMSELAARIGVERTTLTRNLEVMRRDGLVRVMAG
CKRIELTAKGRAALQKAVPLWRGVQAEVTAWPRVRRDIANLGQAAEAC
The query sequence (length=128) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4fx4:B | 133 | 136 | 0.9609 | 0.9248 | 0.9044 | 1.01e-78 | 4fx4:A |
2 | 5hli:A | 146 | 73 | 0.1406 | 0.1233 | 0.2466 | 8.50e-04 | 5hlg:A, 5hlg:B, 5hlg:C, 5hlg:D, 5hlg:E, 5hlg:F, 5hlg:G, 5hlg:H, 5hlh:A, 5hlh:B, 5hlh:C, 5hlh:D, 5hlh:E, 5hlh:F, 5hlh:G, 5hlh:H, 5hli:B |
3 | 6c2s:A | 142 | 105 | 0.2500 | 0.2254 | 0.3048 | 0.001 | 6c28:A, 6c28:D, 6c28:B, 6c28:C, 6c2s:D, 6c2s:B, 6c2s:C |
4 | 3q5f:A | 141 | 97 | 0.2188 | 0.1986 | 0.2887 | 0.002 | 3q5f:B |
5 | 1fx7:A | 230 | 42 | 0.1484 | 0.0826 | 0.4524 | 0.014 | 1b1b:A, 1fx7:B, 1fx7:C, 1fx7:D, 2isz:A, 2isz:B, 2isz:C, 2isz:D, 2it0:A, 2it0:B, 2it0:C, 2it0:D, 1u8r:A, 1u8r:B, 1u8r:C, 1u8r:D, 1u8r:G, 1u8r:H, 1u8r:I, 1u8r:J |
6 | 4aij:B | 142 | 86 | 0.2031 | 0.1831 | 0.3023 | 0.020 | 4aij:A, 4aik:A |
7 | 2fbh:A | 137 | 78 | 0.2266 | 0.2117 | 0.3718 | 0.080 | |
8 | 4l5j:A | 308 | 56 | 0.1406 | 0.0584 | 0.3214 | 0.38 | 4l4z:A, 4l4z:B, 4l50:A, 4l50:B, 4l51:A, 4l51:B, 4l5j:B, 4l5j:C, 4l5j:D |
9 | 4a0l:E | 709 | 48 | 0.1172 | 0.0212 | 0.3125 | 0.51 | 4a0l:H, 8ei1:A, 8ei1:B, 8ei1:C, 8ei1:D |
10 | 1z9c:C | 138 | 66 | 0.1406 | 0.1304 | 0.2727 | 0.73 | 1z9c:A, 1z9c:B, 1z9c:D, 1z9c:E, 1z9c:F |
11 | 3gfi:A | 143 | 68 | 0.1484 | 0.1329 | 0.2794 | 1.7 | 3gez:A, 3gfj:A, 3gfl:A, 3gfm:A, 2yr2:B |
12 | 4a0k:A | 719 | 59 | 0.1328 | 0.0236 | 0.2881 | 1.7 | 7opc:e, 7opd:e |
13 | 5x80:A | 137 | 95 | 0.2422 | 0.2263 | 0.3263 | 2.1 | 5hso:A, 5hso:C, 5hso:D, 5hso:B, 5x7z:A, 5x80:B |
14 | 4p9u:E | 272 | 31 | 0.1094 | 0.0515 | 0.4516 | 2.3 | 4p9u:F, 4p9u:A, 4p9u:B, 4pdk:A, 4pdk:B |
15 | 8qpl:A | 331 | 100 | 0.2109 | 0.0816 | 0.2700 | 2.3 | 8qpl:B |
16 | 7d98:Q | 288 | 45 | 0.1250 | 0.0556 | 0.3556 | 2.4 | 7d98:A, 7d98:B, 7d98:P, 5xxp:A, 5xxp:B |
17 | 5dv5:A | 267 | 31 | 0.1094 | 0.0524 | 0.4516 | 2.5 | 5dv5:B |
18 | 1h9t:A | 232 | 31 | 0.1094 | 0.0603 | 0.4516 | 2.7 | 1h9g:A, 1h9t:B, 1hw2:A, 1hw2:B |
19 | 4czc:A | 305 | 32 | 0.0938 | 0.0393 | 0.3750 | 3.9 | |
20 | 4ev0:D | 214 | 36 | 0.1016 | 0.0607 | 0.3611 | 7.5 | 4ev0:A |