BioLiP

>protein
EAYWNREQEKLNRQYNSHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPH
FARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTS
CPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGH
LALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIENICSYVDLMLVHSRKPQEMIDIWSQLQS

The query sequence (length=313) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8tjc:B	336	321	1.0000	0.9315	0.9751	0.0	7jhi:A, 7jhi:C, 7jhl:A, 7jhl:B, 7jhm:A, 7jhm:B, 7jhn:A, 7jho:A, 7jho:B, 8sz3:A, 8sz3:B, 8tic:A, 8tic:B, 8tic:C, 8tic:D, 8tjc:A, 8tjc:C, 8tjc:D, 6wmm:A, 6wmm:B, 6wmn:A, 6wmn:B, 6wmn:C, 6wmn:D, 6wmo:A, 6wmo:B
2	3f3z:A	272	88	0.0767	0.0882	0.2727	0.91
3	4evi:A	360	28	0.0447	0.0389	0.5000	0.94	4e70:A, 4e70:B, 4evi:B
4	7uv9:K	407	100	0.0895	0.0688	0.2800	1.7	4qwn:A, 4qwn:C, 4qx7:A, 4qx7:C, 4qx8:A, 4qx8:C, 4qxb:A, 4qxb:C, 4qxc:A, 4qxc:C, 4qxh:A, 4qxh:C, 4tn7:A, 4tn7:C, 7uva:A, 7uva:D, 2yu1:A, 2yu2:A
5	8euy:F	240	49	0.0511	0.0667	0.3265	2.2	8esq:F, 8esr:F, 8etc:F, 8etg:F, 8eth:F, 8eti:F, 8etj:F, 8eug:F, 8eui:F, 8eup:F, 8ev3:F
6	8ojc:A	395	45	0.0543	0.0430	0.3778	3.9
7	7mfp:B	354	39	0.0543	0.0480	0.4359	4.1	7mfo:A, 7mfo:B, 7mfo:C, 7mfo:D, 7mfo:E, 7mfo:F, 7mfo:G, 7mfo:H, 7mfo:I, 7mfo:J, 7mfp:A, 7mfp:C, 7mfp:D, 7mfq:A, 7mfq:B, 7mfq:C, 7mfq:D
8	7pua:Cg	487	51	0.0447	0.0287	0.2745	4.9	6hiv:Cg, 6hiw:Cg, 6hiz:Cg, 7pub:Cg, 6sg9:Cg, 6sgb:Cg
9	3hhs:B	656	47	0.0479	0.0229	0.3191	6.2
10	8tqm:A	843	53	0.0543	0.0202	0.3208	8.8
11	6z7n:C	860	88	0.0927	0.0337	0.3295	8.9	6z7n:L

[Back]