BioLiP

>protein
EAYWNREQEKLNRQYNPILSMISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAI
KSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFL
RWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGG
FLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWS
QLQSAHLKC

The query sequence (length=329) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8tjc:B	336	329	0.9909	0.9702	0.9909	0.0	7jhi:A, 7jhi:C, 7jhl:A, 7jhl:B, 7jhm:A, 7jhm:B, 7jhn:A, 7jho:A, 7jho:B, 8sz3:A, 8sz3:B, 8tic:A, 8tic:B, 8tic:C, 8tic:D, 8tjc:A, 8tjc:C, 8tjc:D, 6wmm:A, 6wmm:B, 6wmn:A, 6wmn:B, 6wmn:C, 6wmn:D, 6wmo:A, 6wmo:B
2	3f3z:A	272	88	0.0729	0.0882	0.2727	0.93
3	4evi:A	360	28	0.0426	0.0389	0.5000	1.0	4e70:A, 4e70:B, 4evi:B
4	7pua:Cg	487	59	0.0486	0.0329	0.2712	1.1	6hiv:Cg, 6hiw:Cg, 6hiz:Cg, 7pub:Cg, 6sg9:Cg, 6sgb:Cg
5	7uv9:K	407	100	0.0851	0.0688	0.2800	1.8	4qwn:A, 4qwn:C, 4qx7:A, 4qx7:C, 4qx8:A, 4qx8:C, 4qxb:A, 4qxb:C, 4qxc:A, 4qxc:C, 4qxh:A, 4qxh:C, 4tn7:A, 4tn7:C, 7uva:A, 7uva:D, 2yu1:A, 2yu2:A
6	8ojc:A	395	45	0.0517	0.0430	0.3778	3.6
7	7mfp:B	354	39	0.0517	0.0480	0.4359	4.7	7mfo:A, 7mfo:B, 7mfo:C, 7mfo:D, 7mfo:E, 7mfo:F, 7mfo:G, 7mfo:H, 7mfo:I, 7mfo:J, 7mfp:A, 7mfp:C, 7mfp:D, 7mfq:A, 7mfq:B, 7mfq:C, 7mfq:D
8	3hhs:B	656	47	0.0456	0.0229	0.3191	6.5
9	7aor:r	465	57	0.0517	0.0366	0.2982	8.3

[Back]