BioLiP

>protein
EAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRT
FSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVD

The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6f5u:B	131	131	0.9924	0.9924	0.9924	1.20e-95	6f6i:B, 6f6n:B, 6f6s:B, 8f87:B, 6g95:B, 6g9b:B, 6hro:B, 6hs4:B, 5jq7:B, 5jqb:B, 7lyd:B, 7lyy:B, 7m2d:B, 6nae:B, 7ssq:B, 7ssr:B
2	1mg1:A	450	47	0.0992	0.0289	0.2766	0.43
3	7p6u:A	772	57	0.1527	0.0259	0.3509	0.48	7p6u:B, 7p6u:C, 7p6u:D, 7p6u:E
4	6kaf:B	503	76	0.1908	0.0497	0.3289	0.97	6kac:B, 6kac:b, 6kad:B, 6kad:b, 6kaf:b, 8kde:B, 7pi0:B, 7pi0:b, 7pi5:B, 7pi5:b, 7pin:B, 7pin:b, 7pin:B1, 7pin:b1, 7piw:B, 7piw:b, 7piw:B1, 7piw:b1, 7pnk:B, 7pnk:b, 8r2i:B, 8zee:B
5	6rm3:SL0	157	36	0.0992	0.0828	0.3611	2.1
6	7t3l:J	228	29	0.0992	0.0570	0.4483	3.1	7t3l:K, 7taw:J, 7taw:K, 7tax:J, 7tax:K
7	7kh2:D	415	31	0.0763	0.0241	0.3226	3.9	7kh2:A, 7kh2:B, 7kh2:C
8	6vpq:A	87	59	0.1221	0.1839	0.2712	5.4	6vpq:B, 6vpq:C, 6vpq:E, 6vpq:F, 5vyc:l1, 5vyc:l2, 5vyc:l3, 5vyc:l4, 5vyc:l5, 5vyc:l6
9	3g5i:A	305	129	0.2595	0.1115	0.2636	5.5	3g5i:B, 3g5i:C, 3g5i:D, 1yoe:A
10	8zmr:A	384	36	0.0840	0.0286	0.3056	5.6
11	6kbn:C	504	27	0.0840	0.0218	0.4074	5.6	6kbm:A, 6kbn:A
12	8bd3:B	504	80	0.1908	0.0496	0.3125	7.1	8bd3:b
13	2c1z:A	439	51	0.1069	0.0319	0.2745	7.6	2c1x:A, 2c9z:A
14	8r7i:A	628	30	0.0992	0.0207	0.4333	9.7

[Back]