EAHKESELHQNRLRWVETMKWWEEIGEPHHQQHAASEWEWFRQRVLPAKAAAMGLSEEDAARELRRAVMHETPRWYSRIQ
PPNARSEIKEPRDQRWPSSPKW
The query sequence (length=102) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hiv:BY | 102 | 102 | 1.0000 | 1.0000 | 1.0000 | 1.87e-69 | 6hix:BY |
2 | 7aih:Ay | 142 | 102 | 0.5882 | 0.4225 | 0.5882 | 2.54e-39 | 7ane:Ay |
3 | 6abw:A | 369 | 40 | 0.1176 | 0.0325 | 0.3000 | 1.7 | |
4 | 5jig:A | 118 | 57 | 0.1961 | 0.1695 | 0.3509 | 2.0 | |
5 | 6oix:C | 478 | 80 | 0.2353 | 0.0502 | 0.3000 | 4.4 | 6oix:A, 6oix:B, 6oix:D, 6oix:E, 6oix:F, 7u66:A, 7u66:B, 7u66:C, 7u66:D, 7u66:E, 7u66:F, 7u67:A, 7u67:D, 7u67:C, 7u67:B, 7u67:F, 7u67:E |
6 | 5evo:A | 213 | 56 | 0.1373 | 0.0657 | 0.2500 | 5.4 | |
7 | 6mgb:A | 321 | 49 | 0.1471 | 0.0467 | 0.3061 | 8.7 | |
8 | 2r0y:A | 283 | 28 | 0.1078 | 0.0389 | 0.3929 | 9.0 | |
9 | 7xq5:A | 75 | 34 | 0.1275 | 0.1733 | 0.3824 | 9.1 |