BioLiP

>protein
EAALVEGQVKLRDKWKSRWLVLRKPSPVADCLLMLVYKDKCERSKGLRERSSLTLEDICGLEPALPYEGLAHTLAIICLS
QAVMLGFDSHEAMCAWDTRIRYALGEVHRFHVTVAPGTKLESGPATLHLCNDILVLARDIPPTVMGQWKLSDLRRYGAVP
NGFIFEGGTRCGYWAGVFFLSSAEGEQMSFLFDCIVRGISPTKGPF

The query sequence (length=206) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ml4:C	208	208	1.0000	0.9904	0.9904	2.76e-152	3ml4:A, 3ml4:B, 3ml4:D
2	1xr0:B	129	93	0.1311	0.2093	0.2903	1.84e-04	2mfq:A
3	2kup:A	146	89	0.1311	0.1849	0.3034	6.97e-04	2ys5:A
4	1uef:A	105	56	0.0874	0.1714	0.3214	0.085	1uef:B
5	8c18:A	207	45	0.0728	0.0725	0.3333	0.95
6	1rwc:A	754	38	0.0631	0.0172	0.3421	1.6	1rwf:A, 1rwg:A, 1rwh:A
7	4yd9:A	1656	47	0.0874	0.0109	0.3830	2.0	4yd9:D, 4yd9:G, 4yd9:J, 4yd9:M, 4yd9:P, 4yd9:S, 4yd9:V, 4yd9:Y, 4yd9:b
8	7pt6:2	629	54	0.0874	0.0286	0.3333	2.7	5bk4:2, 5bk4:A, 6eyc:2, 6f0l:A, 6f0l:2, 3ja8:2, 7p30:2, 7p30:A, 7p5z:2, 7p5z:A, 7pt6:B, 7pt7:2, 7pt7:B, 6rqc:2, 6sko:2, 5u8s:2, 7v3u:2, 7v3u:B, 7v3v:2, 7v3v:B, 5v8f:2, 8w7m:2, 7w8g:2, 7w8g:B
9	3tfm:A	208	70	0.1068	0.1058	0.3143	3.3
10	6b8w:B	95	59	0.0583	0.1263	0.2034	3.5
11	8xgc:2	778	54	0.0874	0.0231	0.3333	4.8	8kg6:2, 8kg8:2, 8kg9:2, 8p5e:2, 8p62:2, 8p63:2, 7pmk:2, 7pmn:2, 6ptn:i, 6ptn:2, 6pto:h, 6pto:2, 7qhs:2, 6skl:2, 6u0m:2, 7z13:2, 7z13:a
12	3all:B	371	81	0.1068	0.0593	0.2716	8.6	3alj:A, 3all:A, 3alm:A, 3alm:B, 4gf7:A, 3gmb:A, 3gmb:B, 3gmc:A, 3gmc:B, 4h2n:A, 4h2p:A, 4h2p:B, 4h2p:C, 4h2p:D, 4h2q:A, 4h2r:A, 4h2r:B, 5hxi:A, 4jy2:A, 4jy2:B, 4jy3:A, 4jy3:B

[Back]