BioLiP

>protein
EAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIP

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6evq:A	70	65	0.9846	0.9143	0.9846	2.73e-41	6evq:B, 3gjo:A, 3gjo:B, 3gjo:C, 3gjo:D, 5n74:A, 5n74:B, 5n74:C, 5n74:D, 5n74:E, 5n74:F, 5n74:G, 5n74:H, 7olg:A, 7olg:B
2	5m9e:B	71	49	0.3385	0.3099	0.4490	6.44e-07	5m9e:A, 5m9e:C, 5m9e:D
3	1qs0:A	407	31	0.2000	0.0319	0.4194	0.52
4	4eot:A	92	26	0.2154	0.1522	0.5385	1.1	4eot:B
5	6k02:B	269	45	0.2000	0.0483	0.2889	1.1	6k02:A
6	2wty:B	97	26	0.2000	0.1340	0.5000	1.5	4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A
7	2dq0:A	447	50	0.2154	0.0313	0.2800	1.8	2dq0:B, 2zr2:A, 2zr2:B
8	1htw:A	158	19	0.1692	0.0696	0.5789	2.1	1htw:B, 1htw:C
9	1a05:A	357	63	0.2769	0.0504	0.2857	2.8	1a05:B
10	1y7i:B	262	32	0.1692	0.0420	0.3438	3.1	1xkl:A, 1xkl:B, 1xkl:C, 1xkl:D, 1y7i:A
11	7myl:B	158	24	0.1538	0.0633	0.4167	4.8	5ecc:A, 5ecc:B, 5ecx:A, 5ecx:B, 7myl:A, 7myl:C, 7myl:D, 7myl:E, 7myl:F, 7reg:A, 7reg:B, 7rgj:A, 7rgj:B
12	3acw:A	284	29	0.2000	0.0458	0.4483	6.0	3acx:A, 3acy:A, 3adz:A, 3ae0:A, 3ae0:B, 4e9u:A, 4e9z:A, 4ea0:A, 4ea0:B, 4ea1:A, 4ea2:A, 4f6v:A, 4f6x:A, 3lgz:B, 3npr:A, 3nri:A, 3tfn:A, 3tfp:A, 3tfv:A, 3vje:A, 3vje:B, 3w7f:A, 3w7f:B, 2zcq:A, 2zcr:A, 2zcs:A, 2zy1:A
13	7zlg:A	662	42	0.2000	0.0196	0.3095	10.0	7zli:A, 7zlj:A

[Back]