EAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIP
The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6evq:A | 70 | 65 | 0.9846 | 0.9143 | 0.9846 | 2.73e-41 | 6evq:B, 3gjo:A, 3gjo:B, 3gjo:C, 3gjo:D, 5n74:A, 5n74:B, 5n74:C, 5n74:D, 5n74:E, 5n74:F, 5n74:G, 5n74:H, 7olg:A, 7olg:B |
2 | 5m9e:B | 71 | 49 | 0.3385 | 0.3099 | 0.4490 | 6.44e-07 | 5m9e:A, 5m9e:C, 5m9e:D |
3 | 1qs0:A | 407 | 31 | 0.2000 | 0.0319 | 0.4194 | 0.52 | |
4 | 4eot:A | 92 | 26 | 0.2154 | 0.1522 | 0.5385 | 1.1 | 4eot:B |
5 | 6k02:B | 269 | 45 | 0.2000 | 0.0483 | 0.2889 | 1.1 | 6k02:A |
6 | 2wty:B | 97 | 26 | 0.2000 | 0.1340 | 0.5000 | 1.5 | 4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A |
7 | 2dq0:A | 447 | 50 | 0.2154 | 0.0313 | 0.2800 | 1.8 | 2dq0:B, 2zr2:A, 2zr2:B |
8 | 1htw:A | 158 | 19 | 0.1692 | 0.0696 | 0.5789 | 2.1 | 1htw:B, 1htw:C |
9 | 1a05:A | 357 | 63 | 0.2769 | 0.0504 | 0.2857 | 2.8 | 1a05:B |
10 | 1y7i:B | 262 | 32 | 0.1692 | 0.0420 | 0.3438 | 3.1 | 1xkl:A, 1xkl:B, 1xkl:C, 1xkl:D, 1y7i:A |
11 | 7myl:B | 158 | 24 | 0.1538 | 0.0633 | 0.4167 | 4.8 | 5ecc:A, 5ecc:B, 5ecx:A, 5ecx:B, 7myl:A, 7myl:C, 7myl:D, 7myl:E, 7myl:F, 7reg:A, 7reg:B, 7rgj:A, 7rgj:B |
12 | 3acw:A | 284 | 29 | 0.2000 | 0.0458 | 0.4483 | 6.0 | 3acx:A, 3acy:A, 3adz:A, 3ae0:A, 3ae0:B, 4e9u:A, 4e9z:A, 4ea0:A, 4ea0:B, 4ea1:A, 4ea2:A, 4f6v:A, 4f6x:A, 3lgz:B, 3npr:A, 3nri:A, 3tfn:A, 3tfp:A, 3tfv:A, 3vje:A, 3vje:B, 3w7f:A, 3w7f:B, 2zcq:A, 2zcr:A, 2zcs:A, 2zy1:A |
13 | 7zlg:A | 662 | 42 | 0.2000 | 0.0196 | 0.3095 | 10.0 | 7zli:A, 7zlj:A |