BioLiP

>protein
EAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENDPVLQRIVDILYAT

The query sequence (length=54) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6evq:A	70	58	0.9815	0.7571	0.9138	1.63e-30	6evq:B, 3gjo:A, 3gjo:B, 3gjo:C, 3gjo:D, 5n74:A, 5n74:B, 5n74:C, 5n74:D, 5n74:E, 5n74:F, 5n74:G, 5n74:H, 7olg:A, 7olg:B
2	5m9e:B	71	48	0.4074	0.3099	0.4583	5.86e-07	5m9e:A, 5m9e:C, 5m9e:D
3	4eot:A	92	26	0.2593	0.1522	0.5385	0.74	4eot:B
4	2wty:B	97	26	0.2407	0.1340	0.5000	1.2	4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A
5	5l8e:A	517	32	0.2407	0.0251	0.4062	1.3
6	7myl:B	158	24	0.1852	0.0633	0.4167	2.1	5ecc:A, 5ecc:B, 5ecx:A, 5ecx:B, 7myl:A, 7myl:C, 7myl:D, 7myl:E, 7myl:F, 7reg:A, 7reg:B, 7rgj:A, 7rgj:B
7	2dq0:A	447	33	0.2037	0.0246	0.3333	2.4	2dq0:B, 2zr2:A, 2zr2:B
8	3acw:A	284	29	0.2407	0.0458	0.4483	2.9	3acx:A, 3acy:A, 3adz:A, 3ae0:A, 3ae0:B, 4e9u:A, 4e9z:A, 4ea0:A, 4ea0:B, 4ea1:A, 4ea2:A, 4f6v:A, 4f6x:A, 3lgz:B, 3npr:A, 3nri:A, 3tfn:A, 3tfp:A, 3tfv:A, 3vje:A, 3vje:B, 3w7f:A, 3w7f:B, 2zcq:A, 2zcr:A, 2zcs:A, 2zy1:A
9	7lye:A	122	38	0.2037	0.0902	0.2895	6.2	7lye:B, 7lye:C, 7lye:D
10	3bjw:A	122	36	0.2037	0.0902	0.3056	6.3	3bjw:E, 3bjw:G, 3bjw:B, 3bjw:F, 3bjw:C, 3bjw:D, 3bjw:H, 2qhd:A, 2qhd:B
11	2ggq:A	401	38	0.1667	0.0224	0.2368	8.2	5z09:A, 5z09:B, 5z09:C, 5z09:D

[Back]