BioLiP

>protein
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERA
QSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI

The query sequence (length=117) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3d73:A	119	117	0.9915	0.9748	0.9915	3.69e-84	3bfa:A, 3bfb:A, 3bjh:A, 3cyz:A, 3cyz:B, 3cz0:A, 3cz0:B, 3cz1:A, 3cz1:B, 3d73:B, 3d74:A, 3d74:B, 3d75:A, 3d76:A, 3d77:A, 3d78:A, 3d78:B
2	3k1e:B	116	116	0.2906	0.2931	0.2931	2.49e-16
3	5el2:A	125	117	0.2564	0.2400	0.2564	2.66e-13	5el2:B, 4fqt:A, 4fqt:B, 3n7h:A, 3n7h:B, 3ogn:A, 3ogn:B
4	3r1v:A	124	89	0.1880	0.1774	0.2472	8.07e-08	3r1v:B
5	8bxv:AAA	123	107	0.1966	0.1870	0.2150	4.61e-05	8bxw:AAA
6	8c6e:A	124	105	0.1880	0.1774	0.2095	0.002	3q8i:A
7	3r72:A	122	115	0.1880	0.1803	0.1913	0.004
8	1ooh:A	126	104	0.1880	0.1746	0.2115	0.085	3b6x:A, 3b6x:B, 3b7a:A, 3b86:A, 3b86:B, 2gte:A, 2gte:B, 1oog:A, 1oog:B, 1ooh:B
9	3rzs:A	119	46	0.1197	0.1176	0.3043	0.13	3s0b:A, 3s0d:A, 3s0e:A
10	8izl:A	2067	49	0.1453	0.0082	0.3469	0.18	8izm:A, 8x01:A, 8yxm:A, 8yxp:A
11	2wc5:A	141	92	0.1966	0.1631	0.2500	0.43	2wc6:A, 2wch:A, 2wcj:A, 2wcl:A, 2wcm:A
12	6v4c:A	294	65	0.1880	0.0748	0.3385	0.49
13	6nbn:A	123	97	0.1624	0.1545	0.1959	0.92	6ogh:A, 6oii:A, 6oii:B, 6opb:E, 6opb:F, 6opb:I
14	5gpc:A	190	69	0.1282	0.0789	0.2174	1.2	5gpc:B, 5gpc:C, 5gpc:D
15	3oth:A	395	26	0.1026	0.0304	0.4615	2.9	3otg:A, 3oth:B

[Back]