BioLiP

>protein
DWKPQILAIICNWCSYAGADLAGGARIQYPPTVRAIRVMCTGRVDMLFILKAFVEGADGVLVSGCHFGDCHYLEGNYKAA
KRMFMIKNLLRNIGLDDRRFRMTFVSASEGAKWGMVMEDVTNTIKELGPSPIKEFKK

The query sequence (length=137) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7bkb:F	137	137	1.0000	1.0000	1.0000	5.84e-102	7bkb:f, 7bkc:F, 7bkc:f, 7bkd:F, 7bke:F
2	5odc:D	138	134	0.5182	0.5145	0.5299	4.31e-53	5odc:J, 5odh:D, 5odh:J, 5odi:D, 5odi:J, 5odq:D, 5odq:J, 5odr:D, 5odr:J
3	4ag5:D	270	85	0.1825	0.0926	0.2941	0.032
4	5okn:D	433	90	0.2044	0.0647	0.3111	0.048	4a9c:B, 5okn:C, 5okn:E, 5okn:F, 5okn:H, 6squ:B
5	5okn:G	402	87	0.1898	0.0647	0.2989	0.72	6squ:A
6	6oz6:C	322	64	0.1168	0.0497	0.2500	0.72	8cxr:C, 6oz6:B
7	7vmx:B	359	38	0.1022	0.0390	0.3684	1.6
8	3k30:A	684	124	0.2336	0.0468	0.2581	2.2	3k30:B
9	7paj:9	393	56	0.1095	0.0382	0.2679	3.5	7pak:9, 7pha:9, 7pi9:9, 7pip:9
10	5drv:A	131	23	0.0876	0.0916	0.5217	3.6
11	9ayh:A	1056	77	0.1533	0.0199	0.2727	4.0	9ayg:A, 9ayj:A, 9ayk:A, 9ayl:A
12	6c72:A	579	53	0.0876	0.0207	0.2264	6.0	6c72:B, 6c72:C
13	6ei9:A	306	31	0.0949	0.0425	0.4194	6.0	6ei9:B
14	6tf9:eP1	625	50	0.0949	0.0208	0.2600	6.7
15	8dht:A	440	42	0.1022	0.0318	0.3333	7.1	8dht:B, 8dht:C, 8dht:D
16	3ujm:A	117	64	0.1314	0.1538	0.2812	7.2	3ujm:B

[Back]