Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
DVVTVELVEKVTKKDLNESGSIEGFGPGMMATYWCDVFDTEGKHIGTTVGCMDILYADPESGHLVEHVAEQIRLPDGTIM
AWGTMNRSDVLAQKWITYRCQGTSGRYAGLVGTRTWRIQSLEDESYPIVAKMELRGALE

The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 8of7:A 139 139 1.0000 1.0000 1.0000 1.94e-102
2 8of7:B 119 137 0.8561 1.0000 0.8686 1.81e-78
3 7pxo:AAA 136 91 0.2590 0.2647 0.3956 1.93e-16 7pxo:BBB, 7pxo:DDD
4 7x81:A 145 105 0.2158 0.2069 0.2857 1.40e-04 7x81:B, 7x86:A, 7x86:B, 7x86:C, 7x86:D
5 5bu3:A 181 95 0.2158 0.1657 0.3158 7.37e-04 5bu3:B, 5bu3:C, 5bu3:D, 7dvk:A, 7dvk:B, 7dvk:C, 7dvk:D
6 6nnw:A 208 101 0.1871 0.1250 0.2574 0.003 6nnw:B
7 7lg5:A 871 140 0.2878 0.0459 0.2857 0.12 7lg5:B, 7lg5:C, 7lg5:D, 7lgj:A, 7lgj:B, 7lgj:C, 7lgj:D, 7lgq:A, 7lgq:B, 7lgq:C, 7lgq:D, 7txu:A, 7txu:B, 7txu:C, 7txu:D, 7txv:A, 7txv:B, 7txv:C, 7txv:D
8 2xwn:B 227 50 0.1007 0.0617 0.2800 1.3 3okr:D, 3q7u:A, 3q7u:B, 3q80:A, 3q80:B, 2xwn:A
9 5j67:C 563 28 0.0719 0.0178 0.3571 5.8 5j67:A, 5j68:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218