DVTTAHSDYEIVLEGGSSSWGKVKARAKVNAPPASPLLPADCDVKLNVKPLDPAKGFVRISAVFESIVDSTKNKLTIEAD
IANETKERRISVGEGMVSVGDFSHTFSFEGSVVNLFYYRSDAVRRNVPNPIYMQGRQFHDILMKVPLDNNDLIDTWEGTV
KAIGSTGAFNDWIRDFWFIGPAFTALNEGGQRISRIEVNGLNTESGPKGPVGVSRWRFSHGGSGMVDSISRWAELFPSDK
LNRPAQVEAGFRSDSQGIEVKVDGEFPGVSVDAGGGLRRILNHPLIPLVHHGMVGKFNNFNVDAQLKVVLPKGYKIRYAA
PQYRSQNLEEYRWSGGAYARWVEHVCKGGVGQFEILY
The query sequence (length=357) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7uea:U | 364 | 357 | 1.0000 | 0.9808 | 1.0000 | 0.0 | 3bsd:A, 3eni:A, 3eni:C, 8gwa:1, 8gwa:2, 8gwa:3, 8gwa:4, 8gwa:5, 8gwa:6, 5h8z:A, 5h8z:C, 6m32:E, 6m32:F, 6m32:G, 7uea:V, 7uea:W, 7ueb:U, 7ueb:V, 7ueb:W, 7ueb:X, 7ueb:Y, 7ueb:Z, 7z6q:E, 7z6q:F, 7z6q:G, 7z6q:H, 7z6q:I, 7z6q:J |
| 2 | 6mez:B | 359 | 357 | 0.7815 | 0.7772 | 0.7815 | 0.0 | 4bcl:A, 3eoj:A, 6mez:A, 3vdi:A |
| 3 | 7qok:A | 1361 | 53 | 0.0448 | 0.0118 | 0.3019 | 0.13 | |
| 4 | 7scf:A | 321 | 110 | 0.0728 | 0.0810 | 0.2364 | 0.49 | 7scf:B, 7sew:A, 7sex:A, 7sey:A, 7sf4:A, 7sf4:B, 7sf5:A, 7sf5:B |
| 5 | 7yop:B | 304 | 55 | 0.0420 | 0.0493 | 0.2727 | 2.3 | 8grw:A, 8grw:B, 7yop:A, 7ysz:A, 7ysz:B |
| 6 | 8ivy:A | 451 | 101 | 0.0840 | 0.0665 | 0.2970 | 3.3 | 8ivy:B |
| 7 | 4g68:A | 392 | 165 | 0.1148 | 0.1046 | 0.2485 | 5.7 | 4g68:B |
| 8 | 4biv:A | 269 | 26 | 0.0336 | 0.0446 | 0.4615 | 8.6 | 4biu:C, 4biu:E, 4biu:F, 4biv:B, 4biw:A, 4biw:B, 4bix:A, 4biy:A, 4biy:C, 4biz:A, 4biz:C, 4biz:E, 4biz:F, 4cb0:A, 4cb0:B, 5lfk:A, 5lfk:B |
umich.edu