DVTNAEKLVYKYTNIAHSANPMYEAPSITDGKIFFNRKFKTPSGKEAACASCHTNNPANVGKNIVTGKEIPPLAPRVNTK
RFTDIDKVEDEFTKHCNDILGADCSPSEKANFIAYLLTETKPT
The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1e8e:A | 124 | 123 | 1.0000 | 0.9919 | 1.0000 | 4.99e-89 | 1gu2:A, 1gu2:B, 1oae:A, 1oae:B |
2 | 1dw0:A | 112 | 72 | 0.2439 | 0.2679 | 0.4167 | 1.08e-16 | 1dw0:B, 1dw0:C, 1dw1:A, 1dw1:B, 1dw1:C, 1dw2:A, 1dw2:B, 1dw2:C, 1dw3:A, 1dw3:B, 1dw3:C |
3 | 4eie:A | 82 | 79 | 0.1789 | 0.2683 | 0.2785 | 4.9 | 4eif:A |
4 | 2ebv:A | 57 | 30 | 0.0894 | 0.1930 | 0.3667 | 9.3 |