BioLiP

>protein
DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIK
DAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAEYLAFCGE

The query sequence (length=149) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2k31:A	149	149	1.0000	1.0000	1.0000	1.70e-110
2	2zmf:A	177	150	0.4497	0.3785	0.4467	4.99e-32	2zmf:B
3	3ibj:A	661	148	0.3691	0.0832	0.3716	3.24e-21	4c1i:A, 4c1i:B, 4c1i:C, 4c1i:D, 6c7d:A, 6c7d:B, 6c7d:C, 6c7d:D, 6c7e:A, 6c7e:B, 6c7e:C, 6c7e:D, 6c7f:A, 6c7f:B, 6c7f:C, 6c7g:A, 6c7g:B, 6c7g:C, 6c7g:D, 6c7i:A, 6c7i:B, 6c7i:C, 6c7i:D, 6c7j:A, 6c7j:B, 6c7j:C, 6c7j:D, 4d08:A, 4d08:B, 4d08:C, 4d08:D, 4d09:A, 4d09:B, 4d09:C, 4d09:D, 6ezf:A, 4htx:A, 4htx:B, 4htx:C, 4htx:D, 4htz:A, 4htz:B, 4htz:C, 4htz:D, 3itm:A, 3itm:B, 3itm:C, 3itm:D, 3itu:A, 3itu:B, 3itu:C, 3itu:D, 4jib:A, 4jib:B, 4jib:C, 4jib:D, 1mc0:A, 5tz3:A, 5tz3:B, 5tz3:C, 5tz3:D, 5tza:A, 5tza:B, 5tza:C, 5tza:D, 5tzc:A, 5tzc:B, 5tzc:C, 5tzc:D, 5tzh:A, 5tzh:B, 5tzh:C, 5tzh:D, 5tzw:A, 5tzw:B, 5tzw:C, 5tzw:D, 5tzx:A, 5tzx:B, 5tzx:C, 5tzx:D, 5tzz:A, 5tzz:B, 5tzz:C, 5tzz:D, 5u00:A, 5u00:B, 5u00:C, 5u00:D, 5u7d:A, 5u7d:B, 5u7d:C, 5u7i:A, 5u7i:B, 5u7i:C, 5u7i:D, 5u7j:A, 5u7j:B, 5u7j:C, 5u7j:D, 5u7k:A, 5u7k:B, 5u7k:C, 5u7k:D, 5u7l:A, 5u7l:B, 5u7l:C, 5vp0:A, 5vp0:B, 5vp0:C, 5vp1:A, 5vp1:B, 5vp1:C, 5xkm:A, 5xkm:B, 5xkm:C, 5xkm:D, 5xkm:E, 5xkm:F, 1z1l:A, 6znd:A, 6znd:B, 6zqz:A, 6zqz:B, 6zqz:C, 6zqz:D
4	4mcw:B	363	121	0.3221	0.1322	0.3967	8.99e-20	4mcw:A, 4mdz:A, 4mdz:B, 4me4:A, 4me4:B
5	8ulg:B	824	142	0.3490	0.0631	0.3662	9.72e-18	7jsn:B, 6mzb:B, 8ufi:B, 8ugb:B, 8ugs:B
6	8ulg:B	824	86	0.2081	0.0376	0.3605	3.05e-07	7jsn:B, 6mzb:B, 8ufi:B, 8ugb:B, 8ugs:B
7	8ulg:A	827	136	0.3356	0.0605	0.3676	5.46e-16	7jsn:A, 6mzb:A, 8ufi:A, 8ugb:A, 8ugs:A
8	8ulg:A	827	86	0.1946	0.0351	0.3372	6.01e-06	7jsn:A, 6mzb:A, 8ufi:A, 8ugb:A, 8ugs:A
9	3dba:A	171	147	0.3020	0.2632	0.3061	4.11e-14	3dba:B
10	3ibj:B	643	91	0.2483	0.0575	0.4066	8.96e-14
11	1ykd:A	383	113	0.2819	0.1097	0.3717	1.07e-13	1ykd:B
12	1ykd:A	383	155	0.3289	0.1279	0.3161	2.28e-13	1ykd:B
13	5w10:A	173	119	0.2617	0.2254	0.3277	7.88e-11	5w10:B, 5w10:C, 5w10:D
14	7ri3:C	583	88	0.1745	0.0446	0.2955	0.25	7ri3:A, 7ri3:B, 7ri3:D
15	1fch:A	302	80	0.1342	0.0662	0.2500	0.46	1fch:B, 9gag:A
16	6rrp:B	450	51	0.1141	0.0378	0.3333	2.2
17	6eyv:A	459	51	0.1141	0.0370	0.3333	2.2	6eyv:B, 6rrp:A, 6rrq:A, 6rrq:B
18	8w2d:A	322	36	0.0738	0.0342	0.3056	3.8	8w2d:B
19	8jwf:A	1204	43	0.1074	0.0133	0.3721	6.0	8jwg:A, 8jwi:A
20	6voq:A	207	42	0.1007	0.0725	0.3571	9.7
21	3r1n:A	274	67	0.1208	0.0657	0.2687	9.9	3fhr:A, 3fxw:A, 7nrb:A, 3she:A

[Back]