DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDY
YTGDHYATFSLIDQTC
The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1gmp:A | 96 | 96 | 0.9896 | 0.9896 | 0.9896 | 9.26e-67 | 1gmp:B, 1gmr:A, 1gmr:B, 1rge:A, 1rsn:A, 1rsn:B, 2sar:A |
2 | 3d5i:B | 97 | 91 | 0.5625 | 0.5567 | 0.5934 | 3.10e-36 | 3d4a:B, 3dgy:A, 3dgy:B, 3dh2:A, 3dh2:B, 3dh2:C, 3dh2:D |
3 | 1gov:A | 108 | 79 | 0.2500 | 0.2222 | 0.3038 | 0.43 | 1gov:B, 1goy:A, 1goy:B |
4 | 1rnb:A | 109 | 80 | 0.2812 | 0.2477 | 0.3375 | 0.67 | 1a2p:C, 1b2z:C, 1brg:C, 1brh:C, 1brj:C, 1brk:C, 1brn:L, 1brn:M, 2f4y:C, 2f56:A, 2f56:B, 2f5m:B, 2f5m:C, 2f5w:C |
5 | 1ucr:B | 75 | 54 | 0.1458 | 0.1867 | 0.2593 | 6.8 | 1ucr:A |