DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1j2x:A | 70 | 67 | 1.0000 | 0.9571 | 1.0000 | 3.27e-44 | 2k7l:A, 1onv:A |
2 | 6r6u:A | 458 | 36 | 0.2090 | 0.0306 | 0.3889 | 0.043 | 6r6u:B |
3 | 8tpt:B | 571 | 35 | 0.2090 | 0.0245 | 0.4000 | 0.54 | |
4 | 3zyv:B | 1262 | 33 | 0.2090 | 0.0111 | 0.4242 | 1.8 | 3zyv:A, 3zyv:C, 3zyv:D |
5 | 4v6w:AG | 231 | 17 | 0.1343 | 0.0390 | 0.5294 | 2.2 | 6xu6:AG, 6xu7:AG, 6xu8:AG |
6 | 8c41:A | 720 | 32 | 0.1940 | 0.0181 | 0.4062 | 3.2 | 8c41:B |
7 | 1z16:A | 344 | 35 | 0.1642 | 0.0320 | 0.3143 | 3.4 | 1z17:A, 1z18:A |
8 | 3tz6:A | 342 | 52 | 0.1940 | 0.0380 | 0.2500 | 4.0 | 3vos:A |
9 | 5b2o:A | 1455 | 34 | 0.1940 | 0.0089 | 0.3824 | 4.3 | 5b2p:A, 5b2q:A |
10 | 5xut:A | 1217 | 58 | 0.2388 | 0.0131 | 0.2759 | 5.3 | 5id6:A, 6nm9:B, 6nm9:D, 6nma:B, 6nmc:A, 6nmd:A, 6nme:A, 6omv:B, 5xus:A, 5xuu:A, 5xuz:A, 5xuz:E |
11 | 6kl9:A | 1180 | 58 | 0.2388 | 0.0136 | 0.2759 | 5.9 | |
12 | 6klb:A | 1118 | 58 | 0.2388 | 0.0143 | 0.2759 | 6.2 | 6klb:D |
13 | 2nto:A | 201 | 34 | 0.1791 | 0.0597 | 0.3529 | 6.5 | 2pvq:A |
14 | 4dno:A | 297 | 54 | 0.2239 | 0.0505 | 0.2778 | 6.9 | 4dnf:A, 4dnf:B, 4dnf:C, 4dnf:D, 4dno:B, 4dno:C, 4dno:D, 4ehb:A, 4ehb:B, 4ehb:C, 4ehb:D, 4eus:B, 4eus:D, 5hk9:A, 5hk9:B, 5hk9:D, 5hka:A, 5hka:B, 5hka:C, 5hka:D, 5hkb:A, 5hkb:B, 5hkb:C, 5hkb:D, 5jyc:A, 5jyc:B, 5jyc:C, 5jyc:D, 5tnd:C, 5tnd:D, 5tnd:A, 5tnd:B, 5tne:A, 5tne:C, 5tnf:A, 5tnf:B, 5tnf:C, 5tnf:D, 5tng:A, 5tng:B, 5tng:C, 5tng:D, 5tnh:C, 5tnh:D, 5tnh:A, 5tnh:B, 5tni:A, 5tni:B, 5tni:C, 5tni:D, 5tnj:A, 5tnj:B, 5tnj:C, 5tnj:D, 5tnk:A, 5tnk:B, 5tnk:C, 5tnk:D, 5tnl:A, 5tnl:B, 5tnl:C, 5tnl:D, 5tnm:A, 5tnm:B, 5tnm:C, 5tnm:D, 5tnn:A, 5tnn:B, 5tnn:C, 5tnn:D, 5tnp:A, 5tnp:B, 5tnp:C, 5tnp:D, 5tnq:C, 5tnq:D, 5tnq:A, 5tnq:B, 5tnr:C, 5tnr:D, 5tnr:A, 5tnr:B, 5tns:D, 4yx9:A, 4yx9:B, 4yx9:C, 4yx9:D |
15 | 8e9h:D | 407 | 23 | 0.1493 | 0.0246 | 0.4348 | 7.7 | 8e9g:D |
16 | 7f1m:A | 394 | 30 | 0.1493 | 0.0254 | 0.3333 | 9.7 | 7f1m:B, 5f5o:A, 5f5o:C, 5f5o:E, 5xsq:A, 5xsq:C, 5xsq:E |