BioLiP

>protein
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1l2z:A	62	62	1.0000	1.0000	1.0000	5.50e-43
2	7ruq:A	63	30	0.1613	0.1587	0.3333	0.18	7ruq:C
3	3fma:C	86	30	0.1613	0.1163	0.3333	0.27	3fma:A, 3fma:B, 3fma:D, 3fma:E
4	7rup:A	63	30	0.1452	0.1429	0.3000	1.1
5	2gej:A	361	24	0.1290	0.0222	0.3333	1.5	2gek:A, 4n9w:A
6	6rf0:C	275	33	0.2258	0.0509	0.4242	4.2	8cl7:A, 8cl8:A, 7q36:A, 6rex:A, 6rex:B, 6rex:C, 6rex:D, 6rex:E, 6rez:A, 6rez:B, 6rez:C, 6rez:D, 6rez:E, 6rf0:A, 6rf0:E, 6rf0:B, 6rf0:D, 6rf1:A, 6rf1:E, 6rf1:B, 6rf1:C, 6rf1:D, 6rf3:A, 6rf3:B, 6rf3:C, 6rf3:D, 6rf3:E, 6rf4:A, 6rf4:B, 6rf4:C, 6rf4:D, 6rf4:E, 6rf5:A, 6rf6:A, 6rf7:A, 6rf9:A, 6rfa:A, 6rfb:A, 6rfc:A, 6tk1:A, 6tk2:A, 6tk3:A, 6tk4:A, 6tk5:A, 6tk6:A, 6tk7:A, 3x3b:A, 3x3c:A, 4xtl:A, 4xtn:A, 4xtn:B, 4xtn:C, 4xtn:D, 4xtn:E, 4xtn:F, 4xtn:G, 4xtn:H, 4xtn:I, 4xtn:J, 4xto:A, 4xto:B, 4xto:C, 4xto:D, 4xto:E, 6xyt:A, 6xyt:B, 6xyt:C, 6xyt:D, 6xyt:E, 6yby:A, 6ybz:A, 6ybz:B, 6ybz:C, 6ybz:D, 6ybz:E, 6yc0:A, 6yc0:B, 6yc0:C, 6yc0:D, 6yc0:E, 6yc1:A, 6yc1:B, 6yc1:C, 6yc1:D, 6yc1:E, 6yc2:A, 6yc2:B, 6yc2:C, 6yc2:D, 6yc2:E, 6yc3:A, 6yc3:B, 6yc3:C, 6yc3:D, 6yc3:E, 6yc4:A, 6yc4:B, 6yc4:C, 6yc4:D, 6yc4:E, 6yt4:A, 6yt4:B, 6yt4:D, 6yt4:E, 6yt4:C
7	4yn2:A	281	19	0.1613	0.0356	0.5263	7.5
8	3exs:D	218	18	0.1452	0.0413	0.5000	8.4	3exs:A, 3ext:A

[Back]