DVITVYKDCNYTGFSGGLTIGDYNLARLNSLGVLNDDISSLRITQGYQAILYQDDNFGGASTVINSDNSCLNTTWNDKVS
SIRVIAN
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3hzb:D | 90 | 87 | 1.0000 | 0.9667 | 1.0000 | 8.44e-58 | 3hzb:A, 3hzb:B, 3hzb:C, 3hzb:E, 3hzb:F, 3hzb:G, 3hzb:H |
2 | 3so1:H | 89 | 85 | 0.3563 | 0.3483 | 0.3647 | 1.62e-15 | 5ht8:A, 3i9h:A, 3i9h:B, 3i9h:C, 3i9h:D, 3i9h:E, 3i9h:F, 3i9h:G, 3i9h:H, 3iaj:A, 3sny:A, 3snz:A, 3so0:A, 3so0:B, 3so0:C, 3so0:D, 3so0:E, 3so0:F, 3so0:G, 3so1:A, 3so1:B, 3so1:C, 3so1:D, 3so1:E, 3so1:F, 3so1:G |
3 | 1prr:A | 173 | 84 | 0.3793 | 0.1908 | 0.3929 | 2.12e-12 | 1nps:A, 1prs:A |
4 | 1prr:A | 173 | 79 | 0.3333 | 0.1676 | 0.3671 | 1.02e-07 | 1nps:A, 1prs:A |
5 | 1hdf:A | 100 | 85 | 0.2759 | 0.2400 | 0.2824 | 0.006 | 1hdf:B |
6 | 2k1w:A | 85 | 37 | 0.1839 | 0.1882 | 0.4324 | 0.017 | 5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D |
7 | 4dzh:A | 439 | 29 | 0.1379 | 0.0273 | 0.4138 | 2.2 | |
8 | 1hl7:A | 279 | 21 | 0.1149 | 0.0358 | 0.4762 | 4.8 | 1hl7:B |
9 | 3ci0:K | 280 | 17 | 0.1149 | 0.0357 | 0.5882 | 6.4 | |
10 | 2bv2:A | 83 | 38 | 0.1839 | 0.1928 | 0.4211 | 6.8 | 2bv2:B |