DVFVLDTSVFTNPEIYRTFEEDQRGAMETFIHLALNSRAEFYMPTSVYTEMRKIMDVGELWAEFEMVVKIRSPRRFQLTV
PADFLYEFIEELRYRINKGLRIAEEHTREASGSEDVGKLIARLREKYREALRQGILDSKEDVDVLLLAYELDGVLVSADE
GLRTWADKIGIKLIDPKNFKNILESLVRH
The query sequence (length=189) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8kd9:C | 189 | 189 | 1.0000 | 1.0000 | 1.0000 | 2.89e-138 | 8kd9:E, 8kd9:G, 8kd9:H, 8kd9:D, 8kd9:F, 8kd9:J, 8kd9:I, 8kd9:A |
2 | 8kda:E | 189 | 188 | 0.6825 | 0.6825 | 0.6862 | 4.94e-93 | 8kda:G, 8kda:H, 8kda:F, 8kda:C, 8kda:D, 8kda:I, 8kda:J, 8kda:K, 8kda:A |
3 | 7e8o:A | 194 | 187 | 0.4233 | 0.4124 | 0.4278 | 6.38e-54 | 7e8o:B, 7e8o:C, 7e8o:D |
4 | 2bv3:A | 632 | 171 | 0.2381 | 0.0712 | 0.2632 | 0.045 | 1dar:A |
5 | 2lcq:A | 161 | 35 | 0.0794 | 0.0932 | 0.4286 | 0.36 | |
6 | 3f8h:A | 137 | 74 | 0.0899 | 0.1241 | 0.2297 | 0.71 | |
7 | 7mq8:SB | 440 | 53 | 0.0952 | 0.0409 | 0.3396 | 3.5 | 7mq9:SB, 7mqa:SB |
8 | 7q3g:A | 517 | 94 | 0.1217 | 0.0445 | 0.2447 | 3.6 | 7q3g:E, 7q3g:D, 7q3g:C, 7q3g:B |
9 | 6rxt:UL | 785 | 70 | 0.0952 | 0.0229 | 0.2571 | 5.4 | 6rxu:UL, 6rxv:UL, 6rxx:UL, 6rxy:UL, 6rxz:UL |
10 | 8i54:A | 1113 | 65 | 0.1005 | 0.0171 | 0.2923 | 8.9 |