DVETRLTLAREFMSGVDELPTVPDIVLRIAGKLNDPDVAIDEVADLLLQDQVLTARVVHLANSPLYSAARPISSIRDAVI
YLGLDLLREAIFTCAIVDLFKTGKGPLNRSTLWAHSLGVARIAKLIAERTGFLNPVNVYVAGLLHDVGEVFINFFRGKEF
SQVVTLVDEEKITFGQAEERLFGTSHCEVGFALAKRWSLNEFICDTILYHHDIEAVPYKQAAIVAMVAFADEYCTLRRLG
FEGHKPVDSVRTLLENHPSWGVIRRSLGGSDFDEKLIVAELDSSIVEIRAAVDELFLL
The query sequence (length=298) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3hc1:A | 298 | 298 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 2hek:A | 369 | 43 | 0.0604 | 0.0488 | 0.4186 | 0.12 | 2hek:B |
3 | 2ong:A | 543 | 69 | 0.0772 | 0.0424 | 0.3333 | 0.23 | 2ong:B, 2onh:A, 2onh:B |
4 | 3i0p:A | 361 | 31 | 0.0436 | 0.0360 | 0.4194 | 0.71 |